Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B2H6

Protein Details
Accession A0A0D0B2H6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MLFTRRSRDSRKKPIQTKKTKRQPDEQIDLKHydrophilic
NLS Segment(s)
PositionSequence
8-21RDSRKKPIQTKKTK
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLFTRRSRDSRKKPIQTKKTKRQPDEQIDLKELLARVDASADLPTVLKILTSRGSGSESVLRLGVRITIRPVITCYLDVTRRLEAAPDFLAGNEYNCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.93
4 0.94
5 0.93
6 0.93
7 0.93
8 0.88
9 0.87
10 0.86
11 0.84
12 0.81
13 0.77
14 0.69
15 0.62
16 0.56
17 0.46
18 0.38
19 0.29
20 0.2
21 0.14
22 0.11
23 0.08
24 0.08
25 0.08
26 0.06
27 0.06
28 0.06
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.05
37 0.07
38 0.07
39 0.08
40 0.08
41 0.1
42 0.1
43 0.12
44 0.14
45 0.12
46 0.12
47 0.13
48 0.12
49 0.1
50 0.1
51 0.13
52 0.1
53 0.11
54 0.13
55 0.16
56 0.16
57 0.17
58 0.19
59 0.17
60 0.18
61 0.18
62 0.18
63 0.19
64 0.21
65 0.23
66 0.24
67 0.23
68 0.23
69 0.22
70 0.23
71 0.18
72 0.19
73 0.18
74 0.16
75 0.14
76 0.14
77 0.16
78 0.14