Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A520

Protein Details
Accession A0A0D0A520    Localization Confidence High Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
14-41KADAILSRTTQKKKKKRKADTTASSILVHydrophilic
273-297DRGNGFEKKYFQRHNERKRNTAASYHydrophilic
NLS Segment(s)
PositionSequence
25-31KKKKKRK
161-190DTKAARAEAARKKREREEKEAKKMEWGKGL
199-201RKR
242-248RSKGPRK
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR018609  Bud13  
Gene Ontology GO:0005681  C:spliceosomal complex  
Pfam View protein in Pfam  
PF09736  Bud13  
Amino Acid Sequences MQAYLAEKYMSGPKADAILSRTTQKKKKKRKADTTASSILVDDDAGWVGESSKRIDEEEDFAEAAVAKDRSFKKRRVEEGSGWSTVRAGVKEESPPIPADEQPTVFVEEESEQPFTGGLLTSAQLRKALPKPQLKQEELTKEEEEAAQETVYRDASGRKIDTKAARAEAARKKREREEKEAKKMEWGKGLVQRQEEDARKRQLEKNKSLPFARRADDKELNEELKAKERWNDPAAAFLTKSRSKGPRKPEYTGPPPPPNRFGIKPGYRWDGVDRGNGFEKKYFQRHNERKRNTAASYEWSVDDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.19
5 0.23
6 0.24
7 0.31
8 0.38
9 0.44
10 0.52
11 0.6
12 0.68
13 0.74
14 0.83
15 0.87
16 0.9
17 0.92
18 0.94
19 0.95
20 0.92
21 0.89
22 0.84
23 0.74
24 0.63
25 0.51
26 0.41
27 0.3
28 0.21
29 0.12
30 0.08
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.09
37 0.1
38 0.12
39 0.14
40 0.15
41 0.15
42 0.18
43 0.19
44 0.2
45 0.21
46 0.2
47 0.18
48 0.17
49 0.16
50 0.14
51 0.12
52 0.12
53 0.11
54 0.09
55 0.17
56 0.22
57 0.32
58 0.37
59 0.44
60 0.5
61 0.59
62 0.67
63 0.69
64 0.71
65 0.67
66 0.7
67 0.67
68 0.59
69 0.5
70 0.42
71 0.33
72 0.28
73 0.24
74 0.15
75 0.14
76 0.13
77 0.15
78 0.17
79 0.2
80 0.19
81 0.18
82 0.18
83 0.18
84 0.18
85 0.17
86 0.18
87 0.17
88 0.17
89 0.17
90 0.17
91 0.17
92 0.16
93 0.14
94 0.12
95 0.11
96 0.13
97 0.13
98 0.13
99 0.11
100 0.1
101 0.1
102 0.09
103 0.08
104 0.06
105 0.04
106 0.04
107 0.05
108 0.08
109 0.09
110 0.1
111 0.1
112 0.1
113 0.16
114 0.2
115 0.26
116 0.31
117 0.38
118 0.42
119 0.5
120 0.57
121 0.53
122 0.52
123 0.52
124 0.51
125 0.45
126 0.45
127 0.36
128 0.29
129 0.28
130 0.25
131 0.19
132 0.13
133 0.11
134 0.07
135 0.07
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.07
142 0.1
143 0.12
144 0.12
145 0.14
146 0.15
147 0.2
148 0.22
149 0.24
150 0.25
151 0.23
152 0.24
153 0.22
154 0.3
155 0.33
156 0.4
157 0.44
158 0.45
159 0.48
160 0.55
161 0.64
162 0.63
163 0.64
164 0.67
165 0.69
166 0.75
167 0.77
168 0.69
169 0.67
170 0.65
171 0.58
172 0.52
173 0.43
174 0.38
175 0.39
176 0.43
177 0.38
178 0.35
179 0.33
180 0.3
181 0.36
182 0.37
183 0.36
184 0.39
185 0.42
186 0.43
187 0.47
188 0.5
189 0.53
190 0.57
191 0.59
192 0.62
193 0.63
194 0.65
195 0.64
196 0.63
197 0.6
198 0.56
199 0.51
200 0.47
201 0.45
202 0.48
203 0.52
204 0.47
205 0.46
206 0.45
207 0.43
208 0.37
209 0.36
210 0.29
211 0.3
212 0.3
213 0.26
214 0.28
215 0.3
216 0.36
217 0.35
218 0.38
219 0.3
220 0.35
221 0.35
222 0.3
223 0.28
224 0.23
225 0.28
226 0.26
227 0.28
228 0.29
229 0.37
230 0.45
231 0.52
232 0.6
233 0.64
234 0.68
235 0.71
236 0.73
237 0.73
238 0.73
239 0.75
240 0.73
241 0.72
242 0.73
243 0.73
244 0.68
245 0.63
246 0.61
247 0.54
248 0.51
249 0.52
250 0.51
251 0.51
252 0.53
253 0.55
254 0.5
255 0.49
256 0.47
257 0.44
258 0.4
259 0.42
260 0.37
261 0.35
262 0.41
263 0.41
264 0.39
265 0.36
266 0.4
267 0.41
268 0.49
269 0.53
270 0.55
271 0.64
272 0.73
273 0.8
274 0.85
275 0.84
276 0.83
277 0.84
278 0.82
279 0.74
280 0.7
281 0.62
282 0.58
283 0.55
284 0.49