Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AG74

Protein Details
Accession A0A0D0AG74    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
81-104MMVGKVHRRYHHRRDKVRVPSGWNBasic
NLS Segment(s)
Subcellular Location(s) extr 11, plas 7, mito 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSRSQRWQILVLVRAMCLIIVSKFSVLVFLVVFGGLWDRVICRLREGGARSCESGHPPWLGSTSYWECRLRVLGHSHGVRMMVGKVHRRYHHRRDKVRVPSGWNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.18
4 0.12
5 0.1
6 0.07
7 0.07
8 0.08
9 0.08
10 0.09
11 0.09
12 0.09
13 0.08
14 0.08
15 0.06
16 0.06
17 0.06
18 0.05
19 0.05
20 0.04
21 0.05
22 0.04
23 0.05
24 0.04
25 0.05
26 0.08
27 0.11
28 0.11
29 0.12
30 0.13
31 0.14
32 0.18
33 0.21
34 0.23
35 0.24
36 0.25
37 0.24
38 0.24
39 0.24
40 0.23
41 0.21
42 0.17
43 0.14
44 0.13
45 0.13
46 0.14
47 0.14
48 0.11
49 0.16
50 0.17
51 0.19
52 0.24
53 0.24
54 0.23
55 0.23
56 0.26
57 0.22
58 0.22
59 0.24
60 0.24
61 0.3
62 0.3
63 0.29
64 0.27
65 0.26
66 0.22
67 0.18
68 0.16
69 0.13
70 0.17
71 0.25
72 0.3
73 0.37
74 0.43
75 0.51
76 0.6
77 0.67
78 0.74
79 0.77
80 0.8
81 0.83
82 0.87
83 0.88
84 0.88
85 0.82