Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BKP3

Protein Details
Accession A0A0D0BKP3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
93-119DGPGGKAEKKRLRKENQQRIKDQNFMKHydrophilic
NLS Segment(s)
PositionSequence
98-106KAEKKRLRK
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFLSRSSIRQAFSLRLTRGYAAKSSSAERIPNISAKGTSAAAEEKTLSSCPPGTILEGLNYLKGQPPVIALPDDEYPSWLWDLLKPKVYADDGPGGKAEKKRLRKENQQRIKDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.35
4 0.35
5 0.34
6 0.34
7 0.32
8 0.28
9 0.23
10 0.24
11 0.23
12 0.23
13 0.25
14 0.25
15 0.24
16 0.23
17 0.24
18 0.23
19 0.25
20 0.24
21 0.21
22 0.18
23 0.17
24 0.18
25 0.15
26 0.13
27 0.11
28 0.11
29 0.1
30 0.11
31 0.1
32 0.09
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.09
45 0.11
46 0.1
47 0.09
48 0.09
49 0.08
50 0.09
51 0.09
52 0.09
53 0.07
54 0.08
55 0.08
56 0.1
57 0.1
58 0.08
59 0.09
60 0.1
61 0.11
62 0.1
63 0.1
64 0.1
65 0.1
66 0.11
67 0.09
68 0.09
69 0.12
70 0.18
71 0.2
72 0.25
73 0.24
74 0.24
75 0.27
76 0.28
77 0.25
78 0.23
79 0.27
80 0.23
81 0.23
82 0.24
83 0.23
84 0.25
85 0.28
86 0.35
87 0.36
88 0.46
89 0.55
90 0.64
91 0.72
92 0.79
93 0.86
94 0.88
95 0.89
96 0.88
97 0.86
98 0.86
99 0.83
100 0.8
101 0.73