Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0B2Y1

Protein Details
Accession A0A0D0B2Y1    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
71-93CETGWKGKERHGRRRSSRCGSDKBasic
NLS Segment(s)
PositionSequence
38-53PGTTKHRRGRTSGRKR
77-85GKERHGRRR
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MTRRRNVSDEEIHRHSTGLHQPFPKGNRRVLCWRNARPGTTKHRRGRTSGRKRWILGNVDGQRQRAPADGCETGWKGKERHGRRRSSRCGSDKVRAEMKAPALTEQLMADCEVLTVDREFLDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.39
3 0.36
4 0.37
5 0.36
6 0.37
7 0.36
8 0.38
9 0.44
10 0.49
11 0.52
12 0.48
13 0.48
14 0.47
15 0.51
16 0.58
17 0.57
18 0.61
19 0.61
20 0.63
21 0.66
22 0.64
23 0.61
24 0.56
25 0.59
26 0.6
27 0.61
28 0.65
29 0.63
30 0.69
31 0.69
32 0.7
33 0.73
34 0.74
35 0.75
36 0.74
37 0.74
38 0.7
39 0.68
40 0.67
41 0.62
42 0.55
43 0.47
44 0.47
45 0.41
46 0.42
47 0.42
48 0.37
49 0.31
50 0.28
51 0.25
52 0.19
53 0.17
54 0.13
55 0.16
56 0.16
57 0.15
58 0.18
59 0.19
60 0.17
61 0.19
62 0.21
63 0.17
64 0.24
65 0.33
66 0.39
67 0.49
68 0.57
69 0.64
70 0.71
71 0.8
72 0.83
73 0.82
74 0.83
75 0.78
76 0.78
77 0.74
78 0.72
79 0.69
80 0.65
81 0.61
82 0.53
83 0.48
84 0.44
85 0.42
86 0.37
87 0.31
88 0.27
89 0.23
90 0.22
91 0.21
92 0.17
93 0.14
94 0.11
95 0.11
96 0.09
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.08