Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0AP89

Protein Details
Accession A0A0D0AP89    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
156-212MFKGHKWQRIAEKREKRRALLMRSMPKRVREFKQYYKRRRPNPLKPPRTAKNAKLPFHydrophilic
NLS Segment(s)
PositionSequence
152-209GKKRMFKGHKWQRIAEKREKRRALLMRSMPKRVREFKQYYKRRRPNPLKPPRTAKNAK
Subcellular Location(s) mito 23, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSALQAIKRFRIRELGVTALPSSAFVKPAPKSKLNPSSSRNKVPVASIENPFIPKLNPKTGRWAPPKYSLRRQALLVKKARESGTLALLPPGPKISVIEIAAASRQGIVPRLSASEKSQNVAAPWTRPVEWTGEVKEKKVLGAEVGNRLYAGKKRMFKGHKWQRIAEKREKRRALLMRSMPKRVREFKQYYKRRRPNPLKPPRTAKNAKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.43
3 0.38
4 0.38
5 0.36
6 0.28
7 0.25
8 0.19
9 0.17
10 0.13
11 0.13
12 0.12
13 0.18
14 0.22
15 0.3
16 0.36
17 0.39
18 0.43
19 0.52
20 0.61
21 0.61
22 0.65
23 0.62
24 0.66
25 0.68
26 0.71
27 0.64
28 0.56
29 0.51
30 0.46
31 0.46
32 0.43
33 0.4
34 0.34
35 0.33
36 0.32
37 0.31
38 0.29
39 0.24
40 0.18
41 0.21
42 0.25
43 0.32
44 0.36
45 0.36
46 0.46
47 0.51
48 0.6
49 0.6
50 0.61
51 0.56
52 0.61
53 0.68
54 0.66
55 0.69
56 0.69
57 0.66
58 0.62
59 0.6
60 0.59
61 0.58
62 0.59
63 0.56
64 0.49
65 0.45
66 0.47
67 0.45
68 0.37
69 0.32
70 0.25
71 0.23
72 0.21
73 0.19
74 0.16
75 0.17
76 0.15
77 0.13
78 0.12
79 0.08
80 0.07
81 0.08
82 0.08
83 0.09
84 0.09
85 0.1
86 0.09
87 0.09
88 0.09
89 0.09
90 0.07
91 0.05
92 0.05
93 0.05
94 0.07
95 0.07
96 0.08
97 0.08
98 0.1
99 0.11
100 0.12
101 0.14
102 0.2
103 0.19
104 0.2
105 0.2
106 0.19
107 0.19
108 0.21
109 0.19
110 0.13
111 0.14
112 0.16
113 0.15
114 0.15
115 0.15
116 0.15
117 0.16
118 0.18
119 0.19
120 0.26
121 0.26
122 0.26
123 0.29
124 0.25
125 0.24
126 0.23
127 0.19
128 0.12
129 0.16
130 0.18
131 0.2
132 0.2
133 0.2
134 0.18
135 0.19
136 0.19
137 0.19
138 0.22
139 0.23
140 0.28
141 0.32
142 0.41
143 0.46
144 0.51
145 0.59
146 0.65
147 0.67
148 0.67
149 0.69
150 0.71
151 0.75
152 0.76
153 0.76
154 0.75
155 0.76
156 0.82
157 0.81
158 0.73
159 0.73
160 0.73
161 0.7
162 0.69
163 0.68
164 0.67
165 0.68
166 0.74
167 0.69
168 0.68
169 0.69
170 0.67
171 0.64
172 0.64
173 0.68
174 0.7
175 0.76
176 0.8
177 0.82
178 0.86
179 0.9
180 0.89
181 0.92
182 0.92
183 0.92
184 0.92
185 0.93
186 0.91
187 0.9
188 0.9
189 0.87
190 0.86
191 0.84
192 0.8