Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C9ZGN7

Protein Details
Accession A0A0C9ZGN7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MHHNSQISRPRPQRRHRGLQKLRLAMTHydrophilic
NLS Segment(s)
PositionSequence
12-17PQRRHR
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MHHNSQISRPRPQRRHRGLQKLRLAMTRTPRSAPPPAPPATSPPVAVTTSFKTHLRHIFTRPSYHATPPIVDVAFAQGLQRNAAGGPKDVDDDLIRDEDYHGPHTPDPNLQQQQQAAVVQVDTGEHGRGRSCCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.89
3 0.89
4 0.91
5 0.9
6 0.9
7 0.89
8 0.83
9 0.77
10 0.7
11 0.64
12 0.58
13 0.58
14 0.55
15 0.49
16 0.45
17 0.45
18 0.45
19 0.48
20 0.46
21 0.42
22 0.41
23 0.41
24 0.41
25 0.39
26 0.39
27 0.36
28 0.34
29 0.28
30 0.22
31 0.23
32 0.2
33 0.21
34 0.18
35 0.17
36 0.18
37 0.2
38 0.21
39 0.2
40 0.25
41 0.3
42 0.33
43 0.33
44 0.34
45 0.41
46 0.41
47 0.43
48 0.4
49 0.39
50 0.35
51 0.34
52 0.34
53 0.26
54 0.24
55 0.21
56 0.21
57 0.15
58 0.13
59 0.12
60 0.09
61 0.09
62 0.08
63 0.07
64 0.08
65 0.08
66 0.08
67 0.08
68 0.07
69 0.07
70 0.09
71 0.1
72 0.09
73 0.09
74 0.1
75 0.11
76 0.1
77 0.11
78 0.1
79 0.1
80 0.11
81 0.1
82 0.1
83 0.09
84 0.11
85 0.13
86 0.15
87 0.17
88 0.17
89 0.19
90 0.21
91 0.24
92 0.24
93 0.25
94 0.27
95 0.34
96 0.37
97 0.37
98 0.39
99 0.36
100 0.36
101 0.34
102 0.3
103 0.22
104 0.18
105 0.16
106 0.12
107 0.11
108 0.09
109 0.09
110 0.09
111 0.1
112 0.1
113 0.11
114 0.15