Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AAR5

Protein Details
Accession A0A0D0AAR5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-79WIPQCFSKSRNKYREPKPVRQRHGTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 7, nucl 3.5, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MTASSHYQPFFPLLSWITRFKMLVILLSISIERPSWMAACPTIRLASICGRHHWIPQCFSKSRNKYREPKPVRQRHGTISKFEYMETDGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.23
3 0.24
4 0.24
5 0.25
6 0.24
7 0.22
8 0.24
9 0.2
10 0.18
11 0.15
12 0.14
13 0.12
14 0.12
15 0.12
16 0.08
17 0.08
18 0.07
19 0.06
20 0.06
21 0.06
22 0.07
23 0.07
24 0.08
25 0.09
26 0.1
27 0.1
28 0.11
29 0.1
30 0.1
31 0.09
32 0.1
33 0.13
34 0.18
35 0.19
36 0.19
37 0.23
38 0.24
39 0.29
40 0.34
41 0.33
42 0.31
43 0.37
44 0.41
45 0.39
46 0.42
47 0.48
48 0.51
49 0.58
50 0.63
51 0.66
52 0.7
53 0.78
54 0.85
55 0.83
56 0.84
57 0.85
58 0.86
59 0.85
60 0.84
61 0.79
62 0.77
63 0.79
64 0.71
65 0.67
66 0.61
67 0.58
68 0.5
69 0.46
70 0.38