Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BX37

Protein Details
Accession Q6BX37   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-21NINLKRKAPGNKPVIKKARAHydrophilic
NLS Segment(s)
PositionSequence
7-18RKAPGNKPVIKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
KEGG dha:DEHA2B06248g  -  
Amino Acid Sequences MNINLKRKAPGNKPVIKKARANGFGFNNGEDESSSESETEEMNFEKSIQAKSQKIAKQLAGDNKTDMVEIISQIEEPDSKNVPRKKVEGSKYINKLLDSKKQREKDRILSRQEYNSKQIEENKDAVVFESEDYKKQKEEFLRMKEEERVEDEEPNNAQFYSKLLQSRERRGDPNDTPRSIIANKEDSQEDTNIVHEETNIFSGKNKFNEPMRATRKFNTNIMNYKTNKKEGNQLLDKLKNLIKSKITPDDIRDYKKRYWNRYDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.77
4 0.75
5 0.72
6 0.72
7 0.71
8 0.66
9 0.62
10 0.58
11 0.58
12 0.53
13 0.46
14 0.37
15 0.3
16 0.28
17 0.21
18 0.18
19 0.16
20 0.16
21 0.15
22 0.14
23 0.13
24 0.14
25 0.14
26 0.13
27 0.1
28 0.1
29 0.11
30 0.11
31 0.11
32 0.13
33 0.15
34 0.17
35 0.21
36 0.27
37 0.28
38 0.32
39 0.4
40 0.41
41 0.45
42 0.47
43 0.43
44 0.42
45 0.46
46 0.51
47 0.45
48 0.43
49 0.38
50 0.35
51 0.32
52 0.27
53 0.21
54 0.13
55 0.1
56 0.09
57 0.09
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.11
65 0.13
66 0.15
67 0.24
68 0.29
69 0.34
70 0.37
71 0.4
72 0.44
73 0.51
74 0.54
75 0.55
76 0.57
77 0.6
78 0.61
79 0.63
80 0.56
81 0.47
82 0.48
83 0.44
84 0.46
85 0.44
86 0.48
87 0.52
88 0.58
89 0.63
90 0.65
91 0.67
92 0.68
93 0.71
94 0.71
95 0.69
96 0.67
97 0.63
98 0.62
99 0.62
100 0.55
101 0.49
102 0.43
103 0.38
104 0.35
105 0.38
106 0.36
107 0.33
108 0.31
109 0.27
110 0.25
111 0.23
112 0.21
113 0.16
114 0.11
115 0.08
116 0.12
117 0.12
118 0.15
119 0.17
120 0.18
121 0.18
122 0.18
123 0.23
124 0.21
125 0.3
126 0.34
127 0.38
128 0.43
129 0.43
130 0.44
131 0.44
132 0.41
133 0.33
134 0.28
135 0.27
136 0.22
137 0.24
138 0.23
139 0.21
140 0.2
141 0.2
142 0.17
143 0.13
144 0.12
145 0.08
146 0.1
147 0.1
148 0.12
149 0.15
150 0.16
151 0.25
152 0.3
153 0.39
154 0.44
155 0.46
156 0.48
157 0.48
158 0.54
159 0.52
160 0.57
161 0.55
162 0.48
163 0.46
164 0.43
165 0.43
166 0.36
167 0.33
168 0.26
169 0.25
170 0.25
171 0.26
172 0.27
173 0.25
174 0.26
175 0.24
176 0.21
177 0.16
178 0.16
179 0.15
180 0.14
181 0.12
182 0.1
183 0.1
184 0.09
185 0.11
186 0.1
187 0.09
188 0.13
189 0.19
190 0.24
191 0.26
192 0.28
193 0.3
194 0.34
195 0.43
196 0.45
197 0.49
198 0.52
199 0.56
200 0.58
201 0.58
202 0.62
203 0.57
204 0.58
205 0.55
206 0.54
207 0.56
208 0.57
209 0.6
210 0.55
211 0.6
212 0.6
213 0.59
214 0.57
215 0.51
216 0.55
217 0.55
218 0.61
219 0.59
220 0.59
221 0.6
222 0.6
223 0.59
224 0.54
225 0.49
226 0.47
227 0.44
228 0.44
229 0.42
230 0.43
231 0.5
232 0.54
233 0.57
234 0.52
235 0.54
236 0.58
237 0.59
238 0.62
239 0.62
240 0.59
241 0.62
242 0.68
243 0.72
244 0.71