Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BUH9

Protein Details
Accession A0A0D0BUH9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
26-60SKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGHydrophilic
NLS Segment(s)
PositionSequence
41-59KMKRNPRKVRWTKAFRKAA
113-127SVAREKQRAHRTKKL
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRIEKCYFCSTNVYPGHGSAFVRNDSKVFRFCTSKCHKNFKMKRNPRKVRWTKAFRKAAGKEMTIDSTIDFEKRRNVPVRYDRELIHTTINAMKRIGEIKQRREHAFWKQRMSVAREKQRAHRTKKLAAKSVSVKLLEPTAMEETIGALEKIKVPAKSRSALMKGEGRSMGMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.35
4 0.29
5 0.28
6 0.23
7 0.25
8 0.24
9 0.25
10 0.25
11 0.24
12 0.26
13 0.29
14 0.29
15 0.29
16 0.3
17 0.34
18 0.34
19 0.42
20 0.47
21 0.53
22 0.56
23 0.63
24 0.66
25 0.72
26 0.81
27 0.81
28 0.84
29 0.85
30 0.89
31 0.9
32 0.92
33 0.9
34 0.92
35 0.91
36 0.9
37 0.89
38 0.89
39 0.87
40 0.88
41 0.86
42 0.79
43 0.78
44 0.7
45 0.68
46 0.61
47 0.52
48 0.43
49 0.37
50 0.35
51 0.26
52 0.23
53 0.15
54 0.12
55 0.12
56 0.12
57 0.11
58 0.1
59 0.16
60 0.18
61 0.24
62 0.29
63 0.3
64 0.37
65 0.46
66 0.52
67 0.5
68 0.51
69 0.45
70 0.44
71 0.44
72 0.36
73 0.28
74 0.2
75 0.17
76 0.19
77 0.2
78 0.15
79 0.13
80 0.13
81 0.13
82 0.14
83 0.15
84 0.21
85 0.25
86 0.33
87 0.39
88 0.44
89 0.46
90 0.47
91 0.5
92 0.51
93 0.55
94 0.53
95 0.51
96 0.49
97 0.5
98 0.51
99 0.53
100 0.51
101 0.5
102 0.54
103 0.56
104 0.56
105 0.62
106 0.68
107 0.71
108 0.7
109 0.7
110 0.67
111 0.69
112 0.75
113 0.73
114 0.71
115 0.64
116 0.62
117 0.58
118 0.57
119 0.52
120 0.45
121 0.38
122 0.3
123 0.29
124 0.23
125 0.18
126 0.16
127 0.14
128 0.13
129 0.13
130 0.11
131 0.1
132 0.11
133 0.12
134 0.08
135 0.07
136 0.08
137 0.11
138 0.15
139 0.19
140 0.21
141 0.25
142 0.33
143 0.37
144 0.4
145 0.41
146 0.45
147 0.45
148 0.44
149 0.45
150 0.44
151 0.4
152 0.42
153 0.39
154 0.32
155 0.28