Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BFU5

Protein Details
Accession A0A0D0BFU5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-73QMMQLRIKMRHHKHRQNANRHLRCSRKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
Amino Acid Sequences MGCCSPKPVPAINFSKRATPAMTPASCLTTDQYYYLARLNHVLPQQMMQLRIKMRHHKHRQNANRHLRCSRKECCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.51
3 0.46
4 0.45
5 0.39
6 0.31
7 0.31
8 0.32
9 0.31
10 0.27
11 0.27
12 0.26
13 0.24
14 0.23
15 0.19
16 0.13
17 0.13
18 0.12
19 0.13
20 0.11
21 0.12
22 0.14
23 0.13
24 0.11
25 0.13
26 0.13
27 0.15
28 0.16
29 0.16
30 0.13
31 0.14
32 0.17
33 0.17
34 0.19
35 0.16
36 0.19
37 0.21
38 0.27
39 0.32
40 0.39
41 0.46
42 0.55
43 0.65
44 0.71
45 0.78
46 0.83
47 0.87
48 0.88
49 0.9
50 0.9
51 0.88
52 0.84
53 0.83
54 0.81
55 0.8
56 0.77