Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AQS3

Protein Details
Accession A0A0D0AQS3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-39APALPTPPKNKCKNKCKLQVSNHTRTIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MEAHQADKSVAGAPALPTPPKNKCKNKCKLQVSNHTRTITLPKIKKNSHSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.2
6 0.29
7 0.36
8 0.45
9 0.52
10 0.6
11 0.7
12 0.78
13 0.83
14 0.84
15 0.85
16 0.85
17 0.84
18 0.85
19 0.83
20 0.81
21 0.78
22 0.68
23 0.59
24 0.51
25 0.49
26 0.47
27 0.47
28 0.46
29 0.48
30 0.57
31 0.61