Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0AFN0

Protein Details
Accession A0A0D0AFN0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LANKNVLKKDWPKKPVRPLKPKHydrophilic
NLS Segment(s)
PositionSequence
64-78KKDWPKKPVRPLKPK
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences LEQVEQEKQGKEAEKDKWKALQVAKRSEKASIKVEWQKLQEKHAKDVVNWVAACKELANKNVLKKDWPKKPVRPLKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.51
4 0.51
5 0.49
6 0.52
7 0.52
8 0.51
9 0.48
10 0.55
11 0.57
12 0.55
13 0.54
14 0.53
15 0.49
16 0.46
17 0.43
18 0.34
19 0.36
20 0.39
21 0.41
22 0.39
23 0.39
24 0.43
25 0.4
26 0.44
27 0.43
28 0.38
29 0.39
30 0.41
31 0.38
32 0.3
33 0.36
34 0.32
35 0.3
36 0.28
37 0.25
38 0.19
39 0.19
40 0.19
41 0.12
42 0.15
43 0.14
44 0.17
45 0.21
46 0.24
47 0.31
48 0.37
49 0.38
50 0.4
51 0.46
52 0.54
53 0.59
54 0.65
55 0.68
56 0.72
57 0.82
58 0.85