Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4X0W7

Protein Details
Accession Q4X0W7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
122-144HKGRARAWILKDKRKGHKMPINNBasic
NLS Segment(s)
PositionSequence
118-140APRPHKGRARAWILKDKRKGHKM
Subcellular Location(s) cyto 13, mito 9, pero 3
Family & Domain DBs
KEGG afm:AFUA_2G12040  -  
Amino Acid Sequences MKMAGDKTVEVTPSPRIGIEDSLECLPSIMDASITHGELTQELCLILYLTYSTGGGSLYCLTLTSVAPFPNIASIGGATTQIFCQGLAAPCAEVALGGALTILKWRGCTCNDDNNQRAPRPHKGRARAWILKDKRKGHKMPINN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.17
4 0.19
5 0.2
6 0.2
7 0.18
8 0.18
9 0.19
10 0.18
11 0.16
12 0.14
13 0.12
14 0.09
15 0.09
16 0.06
17 0.06
18 0.05
19 0.1
20 0.11
21 0.12
22 0.12
23 0.11
24 0.11
25 0.11
26 0.12
27 0.08
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.08
58 0.08
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.05
67 0.04
68 0.05
69 0.05
70 0.05
71 0.05
72 0.07
73 0.08
74 0.08
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.04
81 0.04
82 0.03
83 0.03
84 0.02
85 0.03
86 0.03
87 0.03
88 0.04
89 0.05
90 0.05
91 0.07
92 0.08
93 0.12
94 0.14
95 0.21
96 0.25
97 0.35
98 0.41
99 0.48
100 0.5
101 0.55
102 0.59
103 0.56
104 0.58
105 0.54
106 0.58
107 0.58
108 0.65
109 0.65
110 0.68
111 0.72
112 0.74
113 0.78
114 0.75
115 0.73
116 0.75
117 0.75
118 0.76
119 0.78
120 0.78
121 0.78
122 0.81
123 0.8
124 0.8