Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BCI4

Protein Details
Accession A0A0D0BCI4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFKSEIRRPRRQNQSWVCHLTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MFKSEIRRPRRQNQSWVCHLTPVLLRTGPINAALMQISSSKLCISSVLRVGSPAGSAVLPECLQTCADPAMHPVRYTMCS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.81
3 0.8
4 0.7
5 0.6
6 0.52
7 0.44
8 0.37
9 0.29
10 0.23
11 0.16
12 0.16
13 0.15
14 0.16
15 0.13
16 0.1
17 0.1
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.08
32 0.1
33 0.14
34 0.14
35 0.14
36 0.14
37 0.15
38 0.13
39 0.12
40 0.09
41 0.06
42 0.05
43 0.06
44 0.06
45 0.07
46 0.07
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.11
53 0.1
54 0.11
55 0.11
56 0.15
57 0.21
58 0.22
59 0.22
60 0.23