Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0AT90

Protein Details
Accession A0A0D0AT90    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
25-48NQSIRVNRYYRQRRKFNMKFEVGKHydrophilic
142-167PPAEARAPKKPKRLRRDKKSVPYVLVHydrophilic
NLS Segment(s)
PositionSequence
107-111KKAKG
146-160ARAPKKPKRLRRDKK
Subcellular Location(s) cyto 17, nucl 9, cyto_pero 9
Family & Domain DBs
Amino Acid Sequences MLGCLKFGLPPLAIERDEGAVFGINQSIRVNRYYRQRRKFNMKFEVGKGERTYISFFLKLFLNDSVKFSMGKAHDLFERYSGQISAVKKIAEQQKEADFVVAEAERKKAKGKQKVGNLTDNPMESERDTAETDAEGEEKEDPPAEARAPKKPKRLRRDKKSVPYVLVGSEAAPAKAKVGRMSVPSKTVGHAKKCERCTKMDLKCFGIPGLCCSPCRDAKSSCLHSSQHGKRKGSKAAAKAPSTTGTAGTSKSVPVETTIELSEDEGPPPAVRPAKKAKEATPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.19
6 0.15
7 0.12
8 0.11
9 0.11
10 0.13
11 0.1
12 0.12
13 0.13
14 0.16
15 0.16
16 0.2
17 0.23
18 0.25
19 0.36
20 0.46
21 0.55
22 0.63
23 0.71
24 0.76
25 0.85
26 0.88
27 0.87
28 0.86
29 0.84
30 0.79
31 0.73
32 0.74
33 0.64
34 0.6
35 0.51
36 0.44
37 0.37
38 0.33
39 0.32
40 0.24
41 0.27
42 0.23
43 0.22
44 0.2
45 0.21
46 0.2
47 0.19
48 0.2
49 0.21
50 0.2
51 0.23
52 0.23
53 0.21
54 0.21
55 0.19
56 0.21
57 0.18
58 0.23
59 0.21
60 0.21
61 0.23
62 0.25
63 0.25
64 0.21
65 0.22
66 0.18
67 0.18
68 0.16
69 0.15
70 0.17
71 0.18
72 0.19
73 0.18
74 0.18
75 0.17
76 0.23
77 0.29
78 0.28
79 0.29
80 0.29
81 0.3
82 0.32
83 0.32
84 0.25
85 0.18
86 0.15
87 0.15
88 0.12
89 0.1
90 0.09
91 0.12
92 0.12
93 0.13
94 0.17
95 0.22
96 0.31
97 0.39
98 0.48
99 0.52
100 0.61
101 0.69
102 0.69
103 0.7
104 0.62
105 0.55
106 0.47
107 0.4
108 0.32
109 0.24
110 0.21
111 0.13
112 0.13
113 0.11
114 0.11
115 0.11
116 0.1
117 0.09
118 0.08
119 0.08
120 0.07
121 0.07
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.08
131 0.08
132 0.12
133 0.14
134 0.23
135 0.32
136 0.38
137 0.47
138 0.55
139 0.63
140 0.7
141 0.79
142 0.81
143 0.83
144 0.88
145 0.88
146 0.89
147 0.89
148 0.81
149 0.72
150 0.63
151 0.53
152 0.42
153 0.33
154 0.23
155 0.14
156 0.13
157 0.11
158 0.09
159 0.09
160 0.09
161 0.09
162 0.11
163 0.11
164 0.11
165 0.13
166 0.15
167 0.19
168 0.23
169 0.24
170 0.24
171 0.26
172 0.24
173 0.24
174 0.3
175 0.31
176 0.33
177 0.39
178 0.45
179 0.5
180 0.57
181 0.64
182 0.59
183 0.58
184 0.59
185 0.62
186 0.62
187 0.62
188 0.59
189 0.55
190 0.54
191 0.5
192 0.43
193 0.36
194 0.27
195 0.24
196 0.27
197 0.23
198 0.22
199 0.25
200 0.3
201 0.32
202 0.37
203 0.36
204 0.33
205 0.38
206 0.47
207 0.51
208 0.49
209 0.48
210 0.44
211 0.45
212 0.53
213 0.55
214 0.55
215 0.57
216 0.58
217 0.62
218 0.68
219 0.71
220 0.7
221 0.68
222 0.67
223 0.68
224 0.72
225 0.65
226 0.6
227 0.54
228 0.47
229 0.42
230 0.34
231 0.26
232 0.21
233 0.2
234 0.19
235 0.19
236 0.17
237 0.15
238 0.16
239 0.16
240 0.13
241 0.15
242 0.17
243 0.16
244 0.17
245 0.17
246 0.16
247 0.16
248 0.17
249 0.17
250 0.15
251 0.14
252 0.14
253 0.14
254 0.14
255 0.15
256 0.2
257 0.24
258 0.25
259 0.32
260 0.42
261 0.5
262 0.58
263 0.63