Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0C425

Protein Details
Accession A0A0D0C425    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
46-68IVTYRRKHLKARWRDRRYGQSGRBasic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito 8, extr 6, plas 3
Family & Domain DBs
Amino Acid Sequences MVHAVLLGSYVLVIESLRHGQALSARSALALLMNLDQCGWNREVTIVTYRRKHLKARWRDRRYGQSGRLIGITIHLATNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.08
4 0.09
5 0.09
6 0.09
7 0.1
8 0.14
9 0.16
10 0.15
11 0.13
12 0.13
13 0.13
14 0.13
15 0.12
16 0.08
17 0.06
18 0.05
19 0.06
20 0.06
21 0.06
22 0.06
23 0.07
24 0.07
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.09
31 0.1
32 0.16
33 0.19
34 0.22
35 0.26
36 0.3
37 0.36
38 0.39
39 0.45
40 0.47
41 0.52
42 0.59
43 0.67
44 0.75
45 0.75
46 0.8
47 0.82
48 0.84
49 0.82
50 0.79
51 0.74
52 0.72
53 0.66
54 0.59
55 0.51
56 0.41
57 0.33
58 0.25
59 0.22
60 0.13