Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0A5X2

Protein Details
Accession A0A0D0A5X2    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-44AEAMRTPTRQTRKRKLNKVDSDDNSHydrophilic
NLS Segment(s)
PositionSequence
53-64RPAPRAKRIRRE
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MTDDEQQEYQRIQMARKAEAEAMRTPTRQTRKRKLNKVDSDDNSDKENVSLPRPAPRAKRIRREKTGTEWQTVLDLVKFDEEQQRREQNEAVNVADIKTTSVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.28
4 0.29
5 0.27
6 0.28
7 0.3
8 0.29
9 0.32
10 0.31
11 0.3
12 0.3
13 0.34
14 0.42
15 0.47
16 0.53
17 0.58
18 0.66
19 0.76
20 0.84
21 0.86
22 0.87
23 0.88
24 0.86
25 0.84
26 0.76
27 0.74
28 0.66
29 0.57
30 0.48
31 0.39
32 0.31
33 0.22
34 0.23
35 0.15
36 0.14
37 0.16
38 0.15
39 0.21
40 0.23
41 0.28
42 0.29
43 0.36
44 0.45
45 0.5
46 0.6
47 0.65
48 0.72
49 0.76
50 0.78
51 0.74
52 0.71
53 0.74
54 0.67
55 0.59
56 0.49
57 0.41
58 0.35
59 0.31
60 0.24
61 0.13
62 0.1
63 0.08
64 0.09
65 0.09
66 0.1
67 0.19
68 0.21
69 0.24
70 0.31
71 0.38
72 0.38
73 0.41
74 0.42
75 0.38
76 0.42
77 0.41
78 0.35
79 0.3
80 0.29
81 0.26
82 0.24
83 0.19