Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D0BLJ1

Protein Details
Accession A0A0D0BLJ1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
47-68GTYPRRSRLPWITKNRCPRARAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MQHANNIPEGASQATYYTHSLTSFTSLSIRNVGFLWKRVSIHRDTSGTYPRRSRLPWITKNRCPRARAIYADM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.13
5 0.12
6 0.12
7 0.13
8 0.13
9 0.15
10 0.13
11 0.12
12 0.13
13 0.13
14 0.14
15 0.16
16 0.15
17 0.13
18 0.13
19 0.16
20 0.15
21 0.16
22 0.18
23 0.16
24 0.18
25 0.19
26 0.23
27 0.23
28 0.26
29 0.27
30 0.26
31 0.26
32 0.29
33 0.36
34 0.36
35 0.37
36 0.37
37 0.36
38 0.39
39 0.4
40 0.43
41 0.45
42 0.51
43 0.58
44 0.65
45 0.72
46 0.75
47 0.84
48 0.87
49 0.83
50 0.76
51 0.73
52 0.71
53 0.7