Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZHE4

Protein Details
Accession A0A0F7ZHE4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPTPERKARRRKDYPFTLDYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029069  HotDog_dom_sf  
Pfam View protein in Pfam  
PF13279  4HBT_2  
CDD cd00586  4HBT  
Amino Acid Sequences MAPTPERKARRRKDYPFTLDYRTRWNDNDMYDHMNNSVYNFLFDSAVNAYLADHCGIHPPTSSQHPLVAHTSTDYLRSIAYPAVADVGLRISHLGRSSVTYELAVFERGAEEPCAVCDFVHVFVDRATGRPPKDGMGAELRKGLESLHAASTLSKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.83
4 0.78
5 0.74
6 0.7
7 0.62
8 0.61
9 0.55
10 0.51
11 0.45
12 0.46
13 0.42
14 0.38
15 0.42
16 0.35
17 0.37
18 0.34
19 0.32
20 0.28
21 0.25
22 0.23
23 0.18
24 0.18
25 0.12
26 0.12
27 0.12
28 0.12
29 0.11
30 0.11
31 0.12
32 0.1
33 0.1
34 0.09
35 0.09
36 0.08
37 0.08
38 0.09
39 0.07
40 0.06
41 0.06
42 0.1
43 0.11
44 0.12
45 0.11
46 0.12
47 0.14
48 0.18
49 0.21
50 0.17
51 0.19
52 0.19
53 0.21
54 0.22
55 0.2
56 0.16
57 0.14
58 0.15
59 0.12
60 0.12
61 0.11
62 0.09
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.05
69 0.05
70 0.06
71 0.05
72 0.05
73 0.04
74 0.05
75 0.04
76 0.04
77 0.05
78 0.04
79 0.06
80 0.07
81 0.08
82 0.07
83 0.09
84 0.11
85 0.12
86 0.12
87 0.11
88 0.1
89 0.11
90 0.11
91 0.1
92 0.08
93 0.07
94 0.08
95 0.08
96 0.09
97 0.09
98 0.09
99 0.08
100 0.09
101 0.1
102 0.1
103 0.09
104 0.09
105 0.1
106 0.11
107 0.13
108 0.12
109 0.11
110 0.11
111 0.15
112 0.14
113 0.14
114 0.18
115 0.21
116 0.22
117 0.26
118 0.27
119 0.25
120 0.29
121 0.29
122 0.28
123 0.32
124 0.34
125 0.31
126 0.34
127 0.32
128 0.28
129 0.27
130 0.24
131 0.18
132 0.18
133 0.19
134 0.17
135 0.18
136 0.18