Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZGM4

Protein Details
Accession A0A0F7ZGM4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-109ADTGRRRKSRHTSSRDSGDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
CDD cd00048  DSRM_SF  
Amino Acid Sequences MGGFYMQYLESLCRRRGWTDPSYECYRDSSGFTCLVLVNGREYQTDLAYESDLLAQENAAMRAFMVCRNFSVNGGMLARNGIVQGLPAAADTGRRRKSRHTSSRDSGDSRGRRSGNHSSSSSTASFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.39
4 0.43
5 0.43
6 0.47
7 0.5
8 0.51
9 0.55
10 0.53
11 0.48
12 0.44
13 0.4
14 0.32
15 0.3
16 0.25
17 0.21
18 0.21
19 0.19
20 0.17
21 0.14
22 0.14
23 0.13
24 0.11
25 0.11
26 0.12
27 0.13
28 0.12
29 0.13
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.11
56 0.12
57 0.12
58 0.13
59 0.11
60 0.11
61 0.12
62 0.11
63 0.09
64 0.09
65 0.08
66 0.07
67 0.06
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.03
74 0.03
75 0.04
76 0.04
77 0.09
78 0.13
79 0.22
80 0.29
81 0.33
82 0.35
83 0.44
84 0.55
85 0.62
86 0.69
87 0.69
88 0.71
89 0.75
90 0.81
91 0.77
92 0.69
93 0.63
94 0.62
95 0.59
96 0.54
97 0.55
98 0.48
99 0.45
100 0.49
101 0.55
102 0.51
103 0.51
104 0.49
105 0.46
106 0.47
107 0.49