Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZYA6

Protein Details
Accession A0A0F7ZYA6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
14-33ICGVIRRSRTQKPLRYPPGIHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 19, cyto 5, cyto_mito 4.333, cyto_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000477  RT_dom  
Pfam View protein in Pfam  
PF00078  RVT_1  
PROSITE View protein in PROSITE  
PS50878  RT_POL  
Amino Acid Sequences MAAEIRDITGWAVICGVIRRSRTQKPLRYPPGIPSRLVNWVDAFCSGRTASVVVNGHTSESQALPQAGLPQGSLLSPVAFLFFNADLVQRRISDKGGSVAFVDDYSAWVTGPTAESNREGIQSIIDDALHWEKRSGATFEADKTTIIHFTRVAERNTDVPFTIKGNEVKSKDSVKTFGSHHGQSPSYQGTRRQISC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.15
4 0.17
5 0.2
6 0.27
7 0.34
8 0.43
9 0.52
10 0.59
11 0.65
12 0.71
13 0.79
14 0.8
15 0.79
16 0.73
17 0.71
18 0.72
19 0.65
20 0.55
21 0.47
22 0.41
23 0.43
24 0.42
25 0.34
26 0.25
27 0.24
28 0.24
29 0.23
30 0.22
31 0.13
32 0.15
33 0.13
34 0.12
35 0.12
36 0.12
37 0.1
38 0.14
39 0.15
40 0.13
41 0.15
42 0.15
43 0.15
44 0.14
45 0.15
46 0.1
47 0.09
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.11
54 0.1
55 0.1
56 0.09
57 0.08
58 0.08
59 0.08
60 0.08
61 0.06
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.07
69 0.06
70 0.07
71 0.07
72 0.09
73 0.09
74 0.1
75 0.12
76 0.1
77 0.12
78 0.12
79 0.13
80 0.12
81 0.12
82 0.13
83 0.12
84 0.12
85 0.11
86 0.1
87 0.09
88 0.08
89 0.08
90 0.04
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.11
104 0.11
105 0.12
106 0.11
107 0.1
108 0.1
109 0.09
110 0.09
111 0.07
112 0.06
113 0.06
114 0.07
115 0.12
116 0.13
117 0.13
118 0.13
119 0.13
120 0.16
121 0.18
122 0.18
123 0.14
124 0.16
125 0.18
126 0.19
127 0.21
128 0.2
129 0.17
130 0.17
131 0.16
132 0.18
133 0.17
134 0.17
135 0.15
136 0.17
137 0.25
138 0.29
139 0.29
140 0.27
141 0.28
142 0.31
143 0.32
144 0.31
145 0.23
146 0.2
147 0.2
148 0.19
149 0.2
150 0.2
151 0.21
152 0.25
153 0.32
154 0.32
155 0.34
156 0.37
157 0.41
158 0.4
159 0.4
160 0.39
161 0.33
162 0.35
163 0.34
164 0.39
165 0.4
166 0.37
167 0.38
168 0.4
169 0.39
170 0.36
171 0.39
172 0.37
173 0.36
174 0.37
175 0.4
176 0.44