Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A1J7

Protein Details
Accession A0A0F8A1J7   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
133-159GKIRQLTRRIRTKRARREKALRQQYREBasic
NLS Segment(s)
PositionSequence
126-152IRGSEHEGKIRQLTRRIRTKRARREKA
Subcellular Location(s) nucl 12, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR021842  DUF3435  
Pfam View protein in Pfam  
PF11917  DUF3435  
Amino Acid Sequences MERQTLEAGFEKAFGPKAFRRGAANAANGNAPDAVRDQMMRHDPKWATFNSAYINEKVGFHLERVVADEPTEDCLLDLFTHMSLMRDPQARQNMVPDEVWRNLPEDPEIMDLERQREQLKQGKYRIRGSEHEGKIRQLTRRIRTKRARREKALRQQYREYYFYHRPTWDIERQLAGGSRDNDQDTYAAPDIKLHIPERARLAELLCNQPEHLSFDDFSRLRIEIAELMVELASKRETVKRKLISRTPQSSIPVNEKPSKIEDFPLFMNKTQCPRCIGNEAMSLGERTFVYCRPAAMNDHFDREHRATMNGMERDGFIVCNHPGCKEADLKLRSLDHFRDHVSRVHGVTLRQHGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.26
4 0.34
5 0.36
6 0.38
7 0.41
8 0.4
9 0.47
10 0.46
11 0.47
12 0.41
13 0.39
14 0.38
15 0.33
16 0.31
17 0.23
18 0.17
19 0.13
20 0.13
21 0.13
22 0.12
23 0.13
24 0.13
25 0.2
26 0.29
27 0.33
28 0.32
29 0.39
30 0.39
31 0.42
32 0.46
33 0.4
34 0.39
35 0.34
36 0.36
37 0.32
38 0.36
39 0.35
40 0.31
41 0.33
42 0.26
43 0.26
44 0.24
45 0.24
46 0.2
47 0.17
48 0.21
49 0.18
50 0.17
51 0.21
52 0.21
53 0.17
54 0.16
55 0.17
56 0.13
57 0.16
58 0.16
59 0.11
60 0.1
61 0.1
62 0.1
63 0.09
64 0.09
65 0.07
66 0.06
67 0.08
68 0.08
69 0.09
70 0.08
71 0.11
72 0.15
73 0.18
74 0.19
75 0.25
76 0.33
77 0.34
78 0.34
79 0.37
80 0.35
81 0.34
82 0.33
83 0.29
84 0.25
85 0.25
86 0.26
87 0.21
88 0.2
89 0.19
90 0.19
91 0.17
92 0.13
93 0.13
94 0.13
95 0.13
96 0.12
97 0.14
98 0.15
99 0.17
100 0.18
101 0.19
102 0.18
103 0.19
104 0.24
105 0.3
106 0.36
107 0.4
108 0.46
109 0.52
110 0.57
111 0.61
112 0.61
113 0.58
114 0.54
115 0.53
116 0.55
117 0.51
118 0.53
119 0.47
120 0.43
121 0.44
122 0.45
123 0.41
124 0.4
125 0.45
126 0.46
127 0.55
128 0.59
129 0.64
130 0.7
131 0.77
132 0.8
133 0.83
134 0.84
135 0.82
136 0.86
137 0.86
138 0.87
139 0.87
140 0.82
141 0.76
142 0.74
143 0.71
144 0.66
145 0.58
146 0.49
147 0.46
148 0.46
149 0.44
150 0.41
151 0.35
152 0.32
153 0.33
154 0.37
155 0.35
156 0.3
157 0.27
158 0.24
159 0.24
160 0.24
161 0.22
162 0.17
163 0.15
164 0.14
165 0.15
166 0.15
167 0.15
168 0.15
169 0.14
170 0.13
171 0.09
172 0.12
173 0.11
174 0.1
175 0.09
176 0.1
177 0.12
178 0.13
179 0.15
180 0.12
181 0.16
182 0.16
183 0.19
184 0.21
185 0.2
186 0.19
187 0.17
188 0.18
189 0.18
190 0.2
191 0.22
192 0.19
193 0.18
194 0.18
195 0.18
196 0.18
197 0.16
198 0.15
199 0.12
200 0.12
201 0.13
202 0.2
203 0.19
204 0.19
205 0.18
206 0.16
207 0.15
208 0.15
209 0.15
210 0.09
211 0.1
212 0.09
213 0.07
214 0.07
215 0.06
216 0.06
217 0.05
218 0.05
219 0.05
220 0.05
221 0.07
222 0.14
223 0.2
224 0.26
225 0.35
226 0.42
227 0.49
228 0.56
229 0.63
230 0.66
231 0.69
232 0.69
233 0.64
234 0.6
235 0.56
236 0.53
237 0.48
238 0.45
239 0.41
240 0.4
241 0.43
242 0.4
243 0.39
244 0.39
245 0.39
246 0.33
247 0.33
248 0.29
249 0.26
250 0.27
251 0.32
252 0.3
253 0.29
254 0.31
255 0.3
256 0.37
257 0.38
258 0.39
259 0.37
260 0.38
261 0.4
262 0.42
263 0.41
264 0.36
265 0.36
266 0.34
267 0.3
268 0.27
269 0.24
270 0.18
271 0.17
272 0.13
273 0.11
274 0.12
275 0.13
276 0.16
277 0.16
278 0.18
279 0.19
280 0.22
281 0.25
282 0.28
283 0.36
284 0.33
285 0.38
286 0.38
287 0.36
288 0.4
289 0.38
290 0.38
291 0.3
292 0.3
293 0.26
294 0.3
295 0.38
296 0.32
297 0.3
298 0.26
299 0.24
300 0.24
301 0.23
302 0.19
303 0.11
304 0.14
305 0.14
306 0.19
307 0.2
308 0.19
309 0.21
310 0.22
311 0.25
312 0.26
313 0.31
314 0.35
315 0.36
316 0.38
317 0.41
318 0.42
319 0.42
320 0.43
321 0.42
322 0.39
323 0.4
324 0.43
325 0.44
326 0.42
327 0.44
328 0.42
329 0.43
330 0.38
331 0.4
332 0.39
333 0.36
334 0.41