Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZW72

Protein Details
Accession A0A0F7ZW72    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-98GSCQQPRQKKQPKPNALAQGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 24, mito 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKSTSIIFTFLVAGFASAVVAGDQNTPGALDKRIVNNPGAKAPGGGAKPKVQRCEKSSDCPQGLQCLNAAGGPASLVGGSCQQPRQKKQPKPNALAQGSKEQKQQTGPKAQNDLDKDIAQAGKDIFGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.05
5 0.05
6 0.04
7 0.04
8 0.05
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.08
15 0.09
16 0.1
17 0.11
18 0.14
19 0.2
20 0.24
21 0.25
22 0.26
23 0.29
24 0.3
25 0.3
26 0.28
27 0.23
28 0.19
29 0.18
30 0.2
31 0.17
32 0.18
33 0.17
34 0.22
35 0.29
36 0.32
37 0.39
38 0.4
39 0.44
40 0.45
41 0.52
42 0.49
43 0.49
44 0.53
45 0.53
46 0.48
47 0.44
48 0.41
49 0.38
50 0.35
51 0.28
52 0.2
53 0.14
54 0.13
55 0.11
56 0.11
57 0.05
58 0.04
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.05
66 0.07
67 0.09
68 0.13
69 0.18
70 0.26
71 0.32
72 0.43
73 0.51
74 0.59
75 0.68
76 0.75
77 0.8
78 0.79
79 0.81
80 0.8
81 0.74
82 0.69
83 0.61
84 0.6
85 0.55
86 0.52
87 0.49
88 0.41
89 0.4
90 0.43
91 0.48
92 0.46
93 0.52
94 0.55
95 0.56
96 0.6
97 0.6
98 0.59
99 0.56
100 0.53
101 0.46
102 0.41
103 0.35
104 0.33
105 0.32
106 0.25
107 0.23
108 0.18