Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZGW4

Protein Details
Accession A0A0F7ZGW4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVKPLTFKGDKKPKKRKRDKEPATEPTANGBasic
NLS Segment(s)
PositionSequence
8-20KGDKKPKKRKRDK
219-219R
222-222K
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKPKKRKRDKEPATEPTANGDGDDDARAKQVLKTTGGDDDGPEDDSWVSAEAVTDVIGPIVIVLPTDAPSALACDAGGAVFAMPLENVVDNNPATAEPHDVRQVWVANRVSGTESFRLKGHHGRYLACDKYGQLSATSEAVSPLECFNVIATADTPGTFQLQTLRDTLVTIKPNATGKTPAEVRGDADSITFNTTLRIRMQARFKPRLRTSKEEKALSKISRRELEEAAGRKLDEDEIKLLKRARREGDYHEKLLDVKVKGKHDKFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.94
3 0.94
4 0.94
5 0.95
6 0.95
7 0.94
8 0.94
9 0.91
10 0.89
11 0.81
12 0.7
13 0.64
14 0.56
15 0.44
16 0.34
17 0.27
18 0.18
19 0.16
20 0.17
21 0.13
22 0.11
23 0.12
24 0.13
25 0.13
26 0.14
27 0.19
28 0.21
29 0.23
30 0.25
31 0.25
32 0.27
33 0.28
34 0.25
35 0.2
36 0.18
37 0.16
38 0.16
39 0.14
40 0.13
41 0.11
42 0.11
43 0.11
44 0.09
45 0.08
46 0.06
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.04
58 0.03
59 0.03
60 0.03
61 0.04
62 0.05
63 0.06
64 0.06
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.08
93 0.12
94 0.1
95 0.12
96 0.15
97 0.15
98 0.16
99 0.17
100 0.2
101 0.16
102 0.23
103 0.21
104 0.19
105 0.19
106 0.19
107 0.18
108 0.16
109 0.18
110 0.15
111 0.16
112 0.16
113 0.17
114 0.18
115 0.19
116 0.24
117 0.24
118 0.26
119 0.26
120 0.26
121 0.3
122 0.34
123 0.32
124 0.26
125 0.24
126 0.19
127 0.2
128 0.2
129 0.16
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.08
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.07
153 0.06
154 0.08
155 0.07
156 0.07
157 0.11
158 0.13
159 0.14
160 0.15
161 0.15
162 0.14
163 0.15
164 0.16
165 0.16
166 0.17
167 0.17
168 0.16
169 0.19
170 0.22
171 0.22
172 0.22
173 0.21
174 0.2
175 0.25
176 0.26
177 0.26
178 0.26
179 0.26
180 0.25
181 0.23
182 0.23
183 0.17
184 0.16
185 0.13
186 0.11
187 0.12
188 0.11
189 0.08
190 0.1
191 0.11
192 0.13
193 0.14
194 0.2
195 0.21
196 0.27
197 0.36
198 0.4
199 0.48
200 0.56
201 0.6
202 0.63
203 0.69
204 0.73
205 0.72
206 0.74
207 0.74
208 0.74
209 0.78
210 0.74
211 0.68
212 0.65
213 0.65
214 0.62
215 0.61
216 0.56
217 0.56
218 0.55
219 0.56
220 0.54
221 0.47
222 0.46
223 0.45
224 0.43
225 0.39
226 0.34
227 0.31
228 0.27
229 0.27
230 0.26
231 0.21
232 0.2
233 0.22
234 0.25
235 0.27
236 0.31
237 0.35
238 0.35
239 0.4
240 0.45
241 0.47
242 0.49
243 0.52
244 0.57
245 0.62
246 0.66
247 0.61
248 0.54
249 0.48
250 0.43
251 0.43
252 0.41
253 0.32
254 0.32
255 0.36
256 0.44
257 0.53