Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZS39

Protein Details
Accession A0A0F7ZS39   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-32VFEFRPRSRPRRTKGGEWTLEHydrophilic
NLS Segment(s)
PositionSequence
20-22RPR
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004254  AdipoR/HlyIII-related  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF03006  HlyIII  
Amino Acid Sequences MRHDSKRHPLPVFEFRPRSRPRRTKGGEWTLESISDTASKAGKAGRPVLLSFDEMPEWFRRESNQWILHGYRPISGSAHASFCSWSYIHNESVNIYSHLIPAVFFLLGEWYIQQYLTSRYSGVTGADFIAFSIFMLTAVTCLSLSATYHTLMNHSQHLEHFCLRLDMLGVVIFILGDLVLGIYMVFWCEPLSRNIYWSMVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.6
3 0.67
4 0.7
5 0.71
6 0.72
7 0.74
8 0.72
9 0.74
10 0.78
11 0.78
12 0.8
13 0.82
14 0.77
15 0.71
16 0.68
17 0.57
18 0.51
19 0.42
20 0.31
21 0.21
22 0.17
23 0.13
24 0.11
25 0.11
26 0.11
27 0.11
28 0.15
29 0.16
30 0.19
31 0.22
32 0.24
33 0.25
34 0.25
35 0.27
36 0.25
37 0.24
38 0.21
39 0.19
40 0.16
41 0.14
42 0.16
43 0.15
44 0.16
45 0.15
46 0.15
47 0.16
48 0.2
49 0.26
50 0.33
51 0.34
52 0.32
53 0.35
54 0.36
55 0.36
56 0.36
57 0.3
58 0.23
59 0.2
60 0.2
61 0.17
62 0.16
63 0.17
64 0.14
65 0.15
66 0.13
67 0.13
68 0.12
69 0.12
70 0.13
71 0.09
72 0.09
73 0.13
74 0.15
75 0.16
76 0.17
77 0.17
78 0.16
79 0.17
80 0.17
81 0.14
82 0.12
83 0.11
84 0.1
85 0.1
86 0.09
87 0.07
88 0.06
89 0.06
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.08
103 0.1
104 0.1
105 0.1
106 0.1
107 0.11
108 0.12
109 0.11
110 0.08
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.03
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.07
133 0.09
134 0.09
135 0.1
136 0.1
137 0.12
138 0.14
139 0.16
140 0.18
141 0.18
142 0.18
143 0.2
144 0.23
145 0.25
146 0.24
147 0.23
148 0.2
149 0.19
150 0.18
151 0.16
152 0.13
153 0.1
154 0.09
155 0.08
156 0.07
157 0.06
158 0.06
159 0.05
160 0.04
161 0.04
162 0.03
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.03
170 0.03
171 0.04
172 0.04
173 0.04
174 0.06
175 0.07
176 0.1
177 0.14
178 0.19
179 0.19
180 0.21
181 0.24