Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZNP5

Protein Details
Accession A0A0F7ZNP5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-30ADGPARRSRSRSPTRRAPRGSKGFRWKDSHydrophilic
NLS Segment(s)
PositionSequence
6-110ARRSRSRSPTRRAPRGSKGFRWKDSSRGKEDNYGRTDSRSRRDYRDRTSERQAPRDRDRERDRNRDRDWDRGRDRAGDRDGGDRVRSPRRTDSAPKEKKKDKKPA
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MADGPARRSRSRSPTRRAPRGSKGFRWKDSSRGKEDNYGRTDSRSRRDYRDRTSERQAPRDRDRERDRNRDRDWDRGRDRAGDRDGGDRVRSPRRTDSAPKEKKKDKKPAAAAVGPGQEMIIVHVNDRLGTKSAIPCLPSDTIGQLKLMIAARIGRESNQIMLRRQGERPFKDILSLEDYGISNGVQLDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.83
3 0.88
4 0.88
5 0.85
6 0.85
7 0.86
8 0.85
9 0.84
10 0.84
11 0.83
12 0.8
13 0.79
14 0.71
15 0.7
16 0.72
17 0.7
18 0.67
19 0.65
20 0.62
21 0.63
22 0.67
23 0.65
24 0.58
25 0.55
26 0.47
27 0.45
28 0.51
29 0.48
30 0.5
31 0.5
32 0.5
33 0.54
34 0.64
35 0.67
36 0.68
37 0.72
38 0.71
39 0.7
40 0.74
41 0.73
42 0.69
43 0.7
44 0.7
45 0.67
46 0.68
47 0.71
48 0.65
49 0.67
50 0.7
51 0.71
52 0.72
53 0.75
54 0.75
55 0.75
56 0.75
57 0.76
58 0.7
59 0.69
60 0.67
61 0.66
62 0.62
63 0.57
64 0.55
65 0.51
66 0.5
67 0.46
68 0.41
69 0.35
70 0.32
71 0.29
72 0.3
73 0.24
74 0.23
75 0.19
76 0.22
77 0.27
78 0.29
79 0.29
80 0.33
81 0.35
82 0.39
83 0.44
84 0.49
85 0.52
86 0.59
87 0.62
88 0.65
89 0.7
90 0.74
91 0.76
92 0.77
93 0.74
94 0.74
95 0.74
96 0.73
97 0.7
98 0.63
99 0.54
100 0.46
101 0.39
102 0.29
103 0.23
104 0.15
105 0.1
106 0.08
107 0.08
108 0.09
109 0.08
110 0.08
111 0.1
112 0.1
113 0.11
114 0.11
115 0.11
116 0.09
117 0.1
118 0.12
119 0.13
120 0.17
121 0.17
122 0.18
123 0.17
124 0.19
125 0.19
126 0.18
127 0.17
128 0.16
129 0.17
130 0.16
131 0.16
132 0.13
133 0.12
134 0.14
135 0.14
136 0.11
137 0.1
138 0.12
139 0.12
140 0.15
141 0.15
142 0.13
143 0.16
144 0.17
145 0.21
146 0.25
147 0.28
148 0.27
149 0.33
150 0.37
151 0.37
152 0.4
153 0.45
154 0.49
155 0.49
156 0.5
157 0.48
158 0.44
159 0.45
160 0.41
161 0.36
162 0.32
163 0.29
164 0.25
165 0.24
166 0.24
167 0.2
168 0.19
169 0.15
170 0.1
171 0.09
172 0.09
173 0.06
174 0.06
175 0.07
176 0.07