Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E9QVM8

Protein Details
Accession E9QVM8   
Localization Confidence High
Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-147PPRPERSQDHNPRGRRNRRKPKLSAFAKEBasic
NLS Segment(s)
PositionSequence
23-26KKRK
41-74RRKAQKIKSDLIQKAKVKKAYAKIKAKELASAPK
120-192PRPERSQDHNPRGRRNRRKPKLSAFAKEMEIAEKRRKEAERRREEREFKIKDREAMARAKRPAPDGKRKLGRE
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG afm:AFUA_1G12780  -  
Amino Acid Sequences MAKRSRDTDANPQEKRTTEPPVKKRKGFSVGPANLPDGTYRRKAQKIKSDLIQKAKVKKAYAKIKAKELASAPKRPIYAAEEHAEGEITSDNIVDPAPASLELHPDRQAMLNEPVPERPPRPERSQDHNPRGRRNRRKPKLSAFAKEMEIAEKRRKEAERRREEREFKIKDREAMARAKRPAPDGKRKLGRESKVLLNRIQHMVGQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.49
4 0.49
5 0.48
6 0.56
7 0.62
8 0.69
9 0.77
10 0.77
11 0.78
12 0.77
13 0.75
14 0.68
15 0.67
16 0.67
17 0.62
18 0.6
19 0.56
20 0.49
21 0.41
22 0.38
23 0.31
24 0.24
25 0.24
26 0.25
27 0.28
28 0.34
29 0.42
30 0.49
31 0.56
32 0.62
33 0.65
34 0.65
35 0.68
36 0.69
37 0.67
38 0.68
39 0.68
40 0.63
41 0.63
42 0.64
43 0.61
44 0.55
45 0.56
46 0.57
47 0.59
48 0.64
49 0.65
50 0.62
51 0.65
52 0.66
53 0.6
54 0.54
55 0.46
56 0.46
57 0.42
58 0.44
59 0.38
60 0.37
61 0.37
62 0.33
63 0.33
64 0.26
65 0.25
66 0.23
67 0.23
68 0.2
69 0.2
70 0.2
71 0.18
72 0.13
73 0.1
74 0.07
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.03
82 0.03
83 0.03
84 0.04
85 0.04
86 0.05
87 0.05
88 0.1
89 0.11
90 0.12
91 0.13
92 0.13
93 0.13
94 0.14
95 0.14
96 0.13
97 0.15
98 0.16
99 0.16
100 0.17
101 0.18
102 0.18
103 0.2
104 0.18
105 0.22
106 0.26
107 0.29
108 0.35
109 0.43
110 0.47
111 0.53
112 0.63
113 0.67
114 0.7
115 0.73
116 0.72
117 0.73
118 0.78
119 0.81
120 0.81
121 0.82
122 0.84
123 0.86
124 0.9
125 0.89
126 0.88
127 0.88
128 0.84
129 0.79
130 0.71
131 0.64
132 0.56
133 0.49
134 0.39
135 0.32
136 0.28
137 0.27
138 0.31
139 0.3
140 0.3
141 0.36
142 0.41
143 0.48
144 0.55
145 0.62
146 0.65
147 0.68
148 0.74
149 0.77
150 0.78
151 0.77
152 0.77
153 0.73
154 0.67
155 0.72
156 0.66
157 0.61
158 0.6
159 0.56
160 0.49
161 0.52
162 0.53
163 0.51
164 0.53
165 0.53
166 0.51
167 0.51
168 0.57
169 0.57
170 0.61
171 0.6
172 0.66
173 0.71
174 0.72
175 0.77
176 0.77
177 0.72
178 0.68
179 0.66
180 0.66
181 0.65
182 0.65
183 0.59
184 0.55
185 0.55
186 0.51
187 0.47