Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZX42

Protein Details
Accession A0A0F7ZX42    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
32-54RCEGEPRRKRVRAPNTPKPGPKQBasic
NLS Segment(s)
PositionSequence
38-49RRKRVRAPNTPK
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSCSKLPPLRPDRQDQLVLVDLGMNVPLSSPRCEGEPRRKRVRAPNTPKPGPKQLSSGSCCCRAAHELWTNDVLELSRKTYRHEAEISHHKGMLHHLTHTLSEHVEMITVLGEENEDLRREAHDCREMMDKLMAEIDFLRELTGTNARKSEVIPADSDGAYSPLTREAMEEWDNDVVEVVNDSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.54
3 0.5
4 0.43
5 0.37
6 0.29
7 0.23
8 0.17
9 0.14
10 0.13
11 0.08
12 0.05
13 0.05
14 0.09
15 0.1
16 0.13
17 0.15
18 0.15
19 0.18
20 0.24
21 0.33
22 0.4
23 0.48
24 0.54
25 0.63
26 0.67
27 0.72
28 0.77
29 0.79
30 0.79
31 0.79
32 0.81
33 0.81
34 0.83
35 0.81
36 0.77
37 0.76
38 0.68
39 0.6
40 0.55
41 0.51
42 0.52
43 0.5
44 0.51
45 0.44
46 0.43
47 0.42
48 0.36
49 0.33
50 0.29
51 0.26
52 0.27
53 0.31
54 0.28
55 0.29
56 0.3
57 0.28
58 0.24
59 0.22
60 0.15
61 0.11
62 0.1
63 0.12
64 0.14
65 0.14
66 0.18
67 0.24
68 0.25
69 0.26
70 0.28
71 0.26
72 0.29
73 0.38
74 0.4
75 0.34
76 0.33
77 0.3
78 0.28
79 0.29
80 0.29
81 0.19
82 0.15
83 0.16
84 0.16
85 0.16
86 0.16
87 0.14
88 0.09
89 0.09
90 0.08
91 0.07
92 0.06
93 0.06
94 0.05
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.04
102 0.05
103 0.06
104 0.06
105 0.07
106 0.08
107 0.1
108 0.13
109 0.17
110 0.21
111 0.2
112 0.22
113 0.27
114 0.26
115 0.26
116 0.26
117 0.21
118 0.16
119 0.18
120 0.16
121 0.11
122 0.11
123 0.11
124 0.09
125 0.09
126 0.09
127 0.07
128 0.07
129 0.1
130 0.17
131 0.18
132 0.2
133 0.21
134 0.22
135 0.23
136 0.23
137 0.29
138 0.26
139 0.25
140 0.24
141 0.25
142 0.27
143 0.26
144 0.26
145 0.18
146 0.14
147 0.13
148 0.12
149 0.11
150 0.11
151 0.12
152 0.12
153 0.12
154 0.13
155 0.18
156 0.19
157 0.2
158 0.19
159 0.2
160 0.2
161 0.19
162 0.18
163 0.12
164 0.1