Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F8A1K0

Protein Details
Accession A0A0F8A1K0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
118-140AFSQGPVTKKKLRQKRQSAIDILHydrophilic
228-248WSSFVRRRVWIRKRVQKRTIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 10, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006614  Peroxin/Ferlin  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLRVRSSRRAAGLKPSDYDHEIGLVNHDEAQSLSHLSQDAASGEVSSATRLVTPAIDTQPGETDSSPTAENRQAPEQQRAEQAGRDGHDVDNSPEQQQHTTRHESAPDPPIVRPSIEAFSQGPVTKKKLRQKRQSAIDILYENERGGFLCGVALFSSKALGGLDPTAWTNAYHKASPTDIHTAQVPDPSWDWVWPEWRINHDDGVDEHGWEYSFAFSKKFSWHKAKWWSSFVRRRVWIRKRVQKRTIDMSTDPHMLNTDYFRIRPASHQKRLSNGSMHSSRMGGSKSSMSQLSESEMEEKPDIEDMETLLWTLRHARIDREKREAVINYLNHAPDLSELQDEMHEIMSLFIFQASRRQLLSHLMRRHDDTMKELGNKDDEEKNKLRERKEALDAAIKHAEEEVTRLAYWSDVKQMAQDGELRDSLDSEQGWFDANSGLDQSGPPAPNKGKLPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.52
3 0.49
4 0.45
5 0.43
6 0.33
7 0.26
8 0.24
9 0.21
10 0.22
11 0.19
12 0.17
13 0.18
14 0.17
15 0.15
16 0.14
17 0.15
18 0.13
19 0.13
20 0.12
21 0.12
22 0.13
23 0.12
24 0.13
25 0.13
26 0.12
27 0.11
28 0.11
29 0.09
30 0.09
31 0.1
32 0.1
33 0.09
34 0.09
35 0.08
36 0.09
37 0.09
38 0.1
39 0.09
40 0.11
41 0.15
42 0.17
43 0.19
44 0.19
45 0.2
46 0.22
47 0.22
48 0.23
49 0.18
50 0.18
51 0.17
52 0.18
53 0.18
54 0.16
55 0.19
56 0.22
57 0.25
58 0.26
59 0.31
60 0.37
61 0.4
62 0.48
63 0.47
64 0.46
65 0.47
66 0.48
67 0.44
68 0.38
69 0.38
70 0.33
71 0.31
72 0.29
73 0.26
74 0.22
75 0.22
76 0.22
77 0.21
78 0.24
79 0.24
80 0.23
81 0.25
82 0.26
83 0.27
84 0.31
85 0.34
86 0.34
87 0.4
88 0.41
89 0.41
90 0.42
91 0.4
92 0.42
93 0.41
94 0.39
95 0.34
96 0.32
97 0.33
98 0.31
99 0.3
100 0.25
101 0.22
102 0.2
103 0.18
104 0.2
105 0.17
106 0.17
107 0.2
108 0.2
109 0.21
110 0.22
111 0.28
112 0.33
113 0.41
114 0.49
115 0.57
116 0.66
117 0.73
118 0.8
119 0.84
120 0.85
121 0.84
122 0.79
123 0.7
124 0.63
125 0.53
126 0.43
127 0.36
128 0.27
129 0.19
130 0.15
131 0.13
132 0.09
133 0.09
134 0.08
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.06
142 0.06
143 0.06
144 0.05
145 0.06
146 0.05
147 0.05
148 0.05
149 0.06
150 0.06
151 0.06
152 0.07
153 0.07
154 0.07
155 0.08
156 0.09
157 0.14
158 0.16
159 0.16
160 0.17
161 0.18
162 0.19
163 0.2
164 0.22
165 0.22
166 0.2
167 0.2
168 0.21
169 0.21
170 0.2
171 0.22
172 0.18
173 0.13
174 0.14
175 0.15
176 0.14
177 0.12
178 0.14
179 0.12
180 0.15
181 0.16
182 0.19
183 0.19
184 0.21
185 0.24
186 0.23
187 0.23
188 0.2
189 0.19
190 0.16
191 0.2
192 0.17
193 0.14
194 0.13
195 0.11
196 0.11
197 0.1
198 0.1
199 0.06
200 0.07
201 0.08
202 0.08
203 0.09
204 0.11
205 0.17
206 0.21
207 0.26
208 0.33
209 0.35
210 0.43
211 0.53
212 0.58
213 0.55
214 0.57
215 0.56
216 0.57
217 0.63
218 0.6
219 0.56
220 0.54
221 0.57
222 0.62
223 0.65
224 0.66
225 0.67
226 0.72
227 0.76
228 0.81
229 0.82
230 0.79
231 0.75
232 0.73
233 0.67
234 0.61
235 0.52
236 0.45
237 0.4
238 0.36
239 0.31
240 0.22
241 0.19
242 0.16
243 0.15
244 0.13
245 0.14
246 0.12
247 0.13
248 0.14
249 0.15
250 0.15
251 0.22
252 0.32
253 0.38
254 0.45
255 0.52
256 0.53
257 0.57
258 0.61
259 0.56
260 0.49
261 0.41
262 0.39
263 0.34
264 0.33
265 0.28
266 0.24
267 0.21
268 0.2
269 0.19
270 0.13
271 0.12
272 0.13
273 0.14
274 0.16
275 0.16
276 0.14
277 0.14
278 0.14
279 0.15
280 0.14
281 0.13
282 0.15
283 0.14
284 0.15
285 0.15
286 0.14
287 0.12
288 0.13
289 0.13
290 0.09
291 0.09
292 0.08
293 0.09
294 0.08
295 0.08
296 0.07
297 0.06
298 0.06
299 0.1
300 0.12
301 0.16
302 0.17
303 0.24
304 0.34
305 0.44
306 0.49
307 0.53
308 0.52
309 0.48
310 0.53
311 0.47
312 0.41
313 0.39
314 0.34
315 0.29
316 0.31
317 0.3
318 0.24
319 0.23
320 0.18
321 0.12
322 0.13
323 0.11
324 0.09
325 0.09
326 0.09
327 0.09
328 0.1
329 0.1
330 0.08
331 0.07
332 0.06
333 0.07
334 0.06
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.13
341 0.15
342 0.17
343 0.18
344 0.19
345 0.19
346 0.28
347 0.37
348 0.4
349 0.43
350 0.46
351 0.48
352 0.51
353 0.55
354 0.51
355 0.43
356 0.39
357 0.39
358 0.39
359 0.4
360 0.38
361 0.35
362 0.33
363 0.33
364 0.32
365 0.33
366 0.32
367 0.36
368 0.4
369 0.45
370 0.5
371 0.56
372 0.55
373 0.56
374 0.6
375 0.59
376 0.61
377 0.58
378 0.52
379 0.54
380 0.52
381 0.49
382 0.46
383 0.39
384 0.32
385 0.28
386 0.26
387 0.17
388 0.19
389 0.16
390 0.14
391 0.14
392 0.14
393 0.14
394 0.15
395 0.17
396 0.16
397 0.2
398 0.2
399 0.2
400 0.22
401 0.25
402 0.24
403 0.23
404 0.26
405 0.22
406 0.23
407 0.24
408 0.23
409 0.19
410 0.2
411 0.19
412 0.18
413 0.16
414 0.14
415 0.14
416 0.13
417 0.15
418 0.14
419 0.14
420 0.13
421 0.13
422 0.12
423 0.13
424 0.13
425 0.11
426 0.12
427 0.14
428 0.18
429 0.19
430 0.2
431 0.26
432 0.29
433 0.35