Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZZP5

Protein Details
Accession A0A0F7ZZP5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-81RHNGGCCKFRHIRRKYYDCHBasic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 4, plas 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MLVTQFIAAAFLTLGTVSALPQGNPEAAVEVRDTAGMDGDLVARAEAVEAARRKGCPKHYYRHNGGCCKFRHIRRKYYDCHPW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.04
5 0.08
6 0.09
7 0.09
8 0.1
9 0.11
10 0.11
11 0.11
12 0.11
13 0.09
14 0.08
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.08
21 0.05
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.08
36 0.09
37 0.12
38 0.13
39 0.15
40 0.18
41 0.23
42 0.31
43 0.36
44 0.41
45 0.49
46 0.58
47 0.67
48 0.72
49 0.76
50 0.77
51 0.77
52 0.75
53 0.73
54 0.65
55 0.63
56 0.64
57 0.63
58 0.65
59 0.64
60 0.7
61 0.73
62 0.8
63 0.78