Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZMI4

Protein Details
Accession A0A0F7ZMI4    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
51-87DSKPNIRRAEMRKKKKKKKKMKKKKMDKEDNGDKEDKBasic
NLS Segment(s)
PositionSequence
56-77IRRAEMRKKKKKKKKMKKKKMD
Subcellular Location(s) extr 16, E.R. 3, nucl 2, mito 2, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKNFAALFVACLASGALAASAISQNGAARSRLHAVGGTLSALDDAQNGMMDSKPNIRRAEMRKKKKKKKKMKKKKMDKEDNGDKEDKKDTESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.03
5 0.03
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.07
13 0.09
14 0.1
15 0.1
16 0.13
17 0.15
18 0.15
19 0.15
20 0.14
21 0.13
22 0.12
23 0.12
24 0.09
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.06
39 0.13
40 0.17
41 0.22
42 0.23
43 0.24
44 0.32
45 0.4
46 0.5
47 0.54
48 0.62
49 0.68
50 0.78
51 0.88
52 0.91
53 0.94
54 0.94
55 0.95
56 0.96
57 0.96
58 0.96
59 0.97
60 0.97
61 0.97
62 0.97
63 0.97
64 0.94
65 0.93
66 0.93
67 0.88
68 0.82
69 0.77
70 0.67
71 0.6
72 0.58
73 0.48