Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A3Q6

Protein Details
Accession A0A0F8A3Q6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-55ISNAKQESRLKWRKPCKRVAKRGENVEILHydrophilic
NLS Segment(s)
PositionSequence
36-44LKWRKPCKR
Subcellular Location(s) mito 15.5, mito_nucl 10.833, cyto_nucl 5.333, nucl 5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MEFIQIPSSHHFRQLLKLNSRSRRLAISNAKQESRLKWRKPCKRVAKRGENVEILGPEYLVGYAGSVRGLQYIKSNDEQLASKAAVVLAHLSRFKHVRGLRAEASHKPPPFKITWDPNDHAQGVPFPNGQHFRFTFESKSNVDLYLTVMDFGPVFLIEQLYPQQDSAEKVRSRSTQSFLFKVEVPIKLKSDCLVGKGVTHRDIIRMLVTQGKELSWKSLQLPAIWNADQLQLGGGKSYGRDVTLLKSFPSVSSAGWRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.55
4 0.63
5 0.67
6 0.71
7 0.75
8 0.7
9 0.63
10 0.6
11 0.55
12 0.56
13 0.57
14 0.58
15 0.62
16 0.63
17 0.62
18 0.59
19 0.6
20 0.57
21 0.57
22 0.58
23 0.56
24 0.61
25 0.71
26 0.78
27 0.83
28 0.86
29 0.87
30 0.88
31 0.9
32 0.91
33 0.91
34 0.88
35 0.88
36 0.84
37 0.74
38 0.64
39 0.55
40 0.44
41 0.34
42 0.26
43 0.17
44 0.11
45 0.09
46 0.08
47 0.06
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.05
54 0.05
55 0.07
56 0.08
57 0.08
58 0.14
59 0.17
60 0.2
61 0.21
62 0.22
63 0.2
64 0.22
65 0.22
66 0.18
67 0.18
68 0.15
69 0.13
70 0.12
71 0.11
72 0.09
73 0.08
74 0.1
75 0.08
76 0.1
77 0.11
78 0.11
79 0.14
80 0.15
81 0.16
82 0.21
83 0.23
84 0.27
85 0.3
86 0.35
87 0.35
88 0.38
89 0.41
90 0.38
91 0.42
92 0.41
93 0.39
94 0.36
95 0.34
96 0.34
97 0.32
98 0.32
99 0.32
100 0.34
101 0.39
102 0.43
103 0.44
104 0.43
105 0.44
106 0.4
107 0.33
108 0.24
109 0.2
110 0.15
111 0.15
112 0.13
113 0.1
114 0.13
115 0.17
116 0.17
117 0.19
118 0.18
119 0.21
120 0.23
121 0.25
122 0.24
123 0.22
124 0.25
125 0.23
126 0.25
127 0.2
128 0.18
129 0.16
130 0.14
131 0.13
132 0.11
133 0.1
134 0.08
135 0.07
136 0.07
137 0.07
138 0.06
139 0.05
140 0.03
141 0.04
142 0.03
143 0.04
144 0.04
145 0.05
146 0.07
147 0.08
148 0.08
149 0.08
150 0.09
151 0.09
152 0.12
153 0.14
154 0.21
155 0.21
156 0.22
157 0.27
158 0.3
159 0.35
160 0.37
161 0.37
162 0.37
163 0.4
164 0.4
165 0.38
166 0.37
167 0.31
168 0.32
169 0.32
170 0.29
171 0.28
172 0.29
173 0.29
174 0.28
175 0.27
176 0.23
177 0.25
178 0.2
179 0.2
180 0.2
181 0.17
182 0.2
183 0.24
184 0.27
185 0.24
186 0.26
187 0.24
188 0.23
189 0.24
190 0.22
191 0.19
192 0.16
193 0.16
194 0.19
195 0.18
196 0.18
197 0.18
198 0.17
199 0.19
200 0.18
201 0.22
202 0.19
203 0.2
204 0.21
205 0.26
206 0.27
207 0.26
208 0.29
209 0.28
210 0.31
211 0.29
212 0.28
213 0.24
214 0.24
215 0.22
216 0.18
217 0.15
218 0.11
219 0.11
220 0.11
221 0.1
222 0.09
223 0.1
224 0.13
225 0.13
226 0.11
227 0.13
228 0.14
229 0.19
230 0.24
231 0.25
232 0.23
233 0.24
234 0.25
235 0.23
236 0.25
237 0.21
238 0.16