Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZTM6

Protein Details
Accession A0A0F7ZTM6    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSSRSSTKKENNRRKAAAVHydrophilic
80-124DGKQPARATKTKKRIEKRRQKKGSIVFPKYSDKLASRKKKSKVSQHydrophilic
NLS Segment(s)
PositionSequence
84-121PARATKTKKRIEKRRQKKGSIVFPKYSDKLASRKKKSK
Subcellular Location(s) nucl 17, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSSRSSTKKENNRRKAAAVFGPAELARDERLSAKLLELAKQPKPEPVKDVNMNEKEDDAVGEDQENDEGADDTVMDVDGKQPARATKTKKRIEKRRQKKGSIVFPKYSDKLASRKKKSKVSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.79
4 0.73
5 0.68
6 0.62
7 0.56
8 0.47
9 0.37
10 0.35
11 0.29
12 0.26
13 0.2
14 0.16
15 0.12
16 0.11
17 0.11
18 0.11
19 0.13
20 0.13
21 0.13
22 0.13
23 0.16
24 0.16
25 0.18
26 0.21
27 0.25
28 0.26
29 0.3
30 0.3
31 0.32
32 0.36
33 0.35
34 0.35
35 0.36
36 0.39
37 0.4
38 0.44
39 0.46
40 0.44
41 0.44
42 0.38
43 0.33
44 0.27
45 0.21
46 0.17
47 0.11
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.03
65 0.03
66 0.04
67 0.08
68 0.08
69 0.09
70 0.11
71 0.13
72 0.19
73 0.25
74 0.33
75 0.4
76 0.5
77 0.58
78 0.67
79 0.75
80 0.81
81 0.86
82 0.89
83 0.9
84 0.91
85 0.92
86 0.88
87 0.87
88 0.85
89 0.85
90 0.84
91 0.8
92 0.74
93 0.68
94 0.69
95 0.61
96 0.54
97 0.48
98 0.41
99 0.44
100 0.5
101 0.57
102 0.61
103 0.68
104 0.74