Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZJF7

Protein Details
Accession A0A0F7ZJF7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
461-480ESACSPPPADKKPKKTDDSSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004886  Glucanosyltransferase  
IPR017853  Glycoside_hydrolase_SF  
IPR012946  X8  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0042123  F:glucanosyltransferase activity  
GO:0071840  P:cellular component organization or biogenesis  
GO:0071852  P:fungal-type cell wall organization or biogenesis  
Pfam View protein in Pfam  
PF03198  Glyco_hydro_72  
PF07983  X8  
Amino Acid Sequences MAPRRVLLSLLALTGSVMGEFQPIGSKFFYKNGTQFFMKGVAYQQDIAPAGGDNDPTAVYTDPLADVKVCERDIPYLQELGTNTIRTYAINPKLDHSGCMKLLRDAGIYVVSDLGQPSLSINRDDPKWNTELFNRYKAVISELAKYDNVIGFFAGNEVTNNGTNTMASAFVKAAVRDSKAYIKSNKDITRWLGVGYATSDHAEIRAQLAHYFSCDSAEDSVDFWGYNVYSWCGDNTFHGAGWDKQVDFFEYYPVPTFLGEYGCNEIPGGGAARKFQETEALYSGNMTGVFSGGIVYMYHQEANDYGLVKVQNGKVTKLDSFDALKKEVTKAKPEGVSMDSYKPAGKLSECPAVDGKWESHKELPPTPDESLCDCMVKSATCVPKPDLSPKQYGELFGLVCSDKDACAGIKGDAKSGVYGAYNMCSDVAKLTHVLDAYSRKYKGGNSCDWGGKAVTQKASAESACSPPPADKKPKKTDDSSAAHGISLSRPFTLGGFALNMYVLAAVGTGVAMVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.06
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.12
10 0.13
11 0.16
12 0.18
13 0.21
14 0.22
15 0.27
16 0.32
17 0.3
18 0.36
19 0.39
20 0.43
21 0.42
22 0.41
23 0.37
24 0.37
25 0.32
26 0.27
27 0.25
28 0.24
29 0.24
30 0.24
31 0.22
32 0.22
33 0.22
34 0.21
35 0.18
36 0.14
37 0.14
38 0.14
39 0.14
40 0.09
41 0.09
42 0.09
43 0.09
44 0.11
45 0.09
46 0.09
47 0.09
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.11
54 0.14
55 0.18
56 0.17
57 0.18
58 0.19
59 0.22
60 0.25
61 0.29
62 0.28
63 0.25
64 0.24
65 0.26
66 0.25
67 0.26
68 0.26
69 0.21
70 0.19
71 0.2
72 0.2
73 0.17
74 0.21
75 0.25
76 0.3
77 0.35
78 0.36
79 0.36
80 0.43
81 0.43
82 0.41
83 0.36
84 0.33
85 0.3
86 0.34
87 0.32
88 0.27
89 0.28
90 0.27
91 0.24
92 0.19
93 0.17
94 0.14
95 0.13
96 0.11
97 0.09
98 0.08
99 0.08
100 0.08
101 0.07
102 0.06
103 0.06
104 0.07
105 0.11
106 0.12
107 0.13
108 0.15
109 0.19
110 0.21
111 0.26
112 0.28
113 0.28
114 0.29
115 0.29
116 0.3
117 0.31
118 0.37
119 0.37
120 0.4
121 0.38
122 0.36
123 0.36
124 0.33
125 0.32
126 0.29
127 0.26
128 0.24
129 0.24
130 0.26
131 0.24
132 0.23
133 0.21
134 0.17
135 0.16
136 0.12
137 0.1
138 0.08
139 0.08
140 0.08
141 0.07
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.09
148 0.09
149 0.09
150 0.08
151 0.09
152 0.09
153 0.08
154 0.07
155 0.08
156 0.07
157 0.09
158 0.11
159 0.1
160 0.13
161 0.14
162 0.16
163 0.16
164 0.18
165 0.23
166 0.26
167 0.31
168 0.33
169 0.36
170 0.39
171 0.46
172 0.48
173 0.43
174 0.43
175 0.4
176 0.39
177 0.34
178 0.3
179 0.23
180 0.19
181 0.17
182 0.14
183 0.12
184 0.09
185 0.09
186 0.09
187 0.07
188 0.07
189 0.07
190 0.06
191 0.07
192 0.08
193 0.08
194 0.08
195 0.1
196 0.09
197 0.1
198 0.11
199 0.09
200 0.09
201 0.09
202 0.09
203 0.09
204 0.1
205 0.09
206 0.08
207 0.09
208 0.08
209 0.07
210 0.06
211 0.06
212 0.05
213 0.06
214 0.06
215 0.06
216 0.07
217 0.07
218 0.08
219 0.08
220 0.08
221 0.08
222 0.11
223 0.11
224 0.1
225 0.11
226 0.12
227 0.12
228 0.14
229 0.15
230 0.11
231 0.11
232 0.12
233 0.13
234 0.12
235 0.12
236 0.12
237 0.1
238 0.11
239 0.11
240 0.11
241 0.1
242 0.08
243 0.08
244 0.07
245 0.08
246 0.08
247 0.08
248 0.11
249 0.1
250 0.1
251 0.1
252 0.09
253 0.07
254 0.07
255 0.08
256 0.05
257 0.06
258 0.07
259 0.08
260 0.09
261 0.09
262 0.09
263 0.14
264 0.13
265 0.15
266 0.16
267 0.15
268 0.15
269 0.14
270 0.14
271 0.1
272 0.08
273 0.06
274 0.04
275 0.04
276 0.04
277 0.04
278 0.04
279 0.03
280 0.04
281 0.04
282 0.04
283 0.06
284 0.06
285 0.07
286 0.07
287 0.07
288 0.07
289 0.08
290 0.09
291 0.08
292 0.08
293 0.1
294 0.1
295 0.1
296 0.14
297 0.14
298 0.18
299 0.18
300 0.19
301 0.19
302 0.21
303 0.21
304 0.2
305 0.19
306 0.16
307 0.18
308 0.21
309 0.21
310 0.21
311 0.21
312 0.2
313 0.23
314 0.28
315 0.27
316 0.3
317 0.3
318 0.34
319 0.35
320 0.34
321 0.33
322 0.28
323 0.28
324 0.25
325 0.24
326 0.2
327 0.19
328 0.19
329 0.17
330 0.16
331 0.14
332 0.13
333 0.15
334 0.18
335 0.25
336 0.24
337 0.26
338 0.27
339 0.25
340 0.26
341 0.23
342 0.21
343 0.21
344 0.23
345 0.24
346 0.29
347 0.32
348 0.35
349 0.38
350 0.4
351 0.35
352 0.37
353 0.36
354 0.32
355 0.3
356 0.28
357 0.27
358 0.24
359 0.22
360 0.17
361 0.17
362 0.17
363 0.15
364 0.13
365 0.17
366 0.23
367 0.25
368 0.28
369 0.3
370 0.34
371 0.37
372 0.44
373 0.46
374 0.44
375 0.48
376 0.46
377 0.49
378 0.44
379 0.42
380 0.35
381 0.29
382 0.24
383 0.18
384 0.18
385 0.13
386 0.12
387 0.12
388 0.11
389 0.08
390 0.09
391 0.1
392 0.08
393 0.1
394 0.11
395 0.12
396 0.18
397 0.18
398 0.19
399 0.2
400 0.2
401 0.18
402 0.17
403 0.16
404 0.1
405 0.11
406 0.1
407 0.11
408 0.11
409 0.1
410 0.11
411 0.1
412 0.09
413 0.1
414 0.1
415 0.1
416 0.11
417 0.11
418 0.13
419 0.13
420 0.13
421 0.15
422 0.2
423 0.24
424 0.3
425 0.29
426 0.28
427 0.31
428 0.36
429 0.42
430 0.44
431 0.46
432 0.44
433 0.49
434 0.51
435 0.5
436 0.45
437 0.37
438 0.33
439 0.32
440 0.33
441 0.3
442 0.29
443 0.29
444 0.29
445 0.32
446 0.28
447 0.25
448 0.22
449 0.24
450 0.24
451 0.24
452 0.22
453 0.25
454 0.32
455 0.38
456 0.47
457 0.53
458 0.61
459 0.71
460 0.8
461 0.81
462 0.8
463 0.8
464 0.79
465 0.75
466 0.71
467 0.66
468 0.57
469 0.49
470 0.44
471 0.36
472 0.3
473 0.28
474 0.23
475 0.17
476 0.17
477 0.18
478 0.17
479 0.19
480 0.15
481 0.12
482 0.12
483 0.12
484 0.12
485 0.11
486 0.1
487 0.08
488 0.08
489 0.06
490 0.04
491 0.04
492 0.03
493 0.03
494 0.03
495 0.03