Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZKJ1

Protein Details
Accession A0A0F7ZKJ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-115SKYPSSDRHIRSRRVRSVRCVRERRHHBasic
NLS Segment(s)
Subcellular Location(s) extr 19, cyto 3, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001064  Beta/gamma_crystallin  
IPR011024  G_crystallin-like  
Pfam View protein in Pfam  
PF00030  Crystall  
PROSITE View protein in PROSITE  
PS50915  CRYSTALLIN_BETA_GAMMA  
Amino Acid Sequences MLVTTVFALAFAALVAAEGAEVEHEHEARAPYAATLYSQPNFRGHSRRIDTGRCYDLRGPLRNDVQSIRVDRGDDCYLYERDNCHGRSSKYPSSDRHIRSRRVRSVRCVRERRHH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.02
6 0.03
7 0.03
8 0.03
9 0.05
10 0.06
11 0.07
12 0.07
13 0.09
14 0.1
15 0.1
16 0.11
17 0.1
18 0.08
19 0.09
20 0.09
21 0.08
22 0.09
23 0.12
24 0.13
25 0.15
26 0.17
27 0.18
28 0.21
29 0.24
30 0.28
31 0.28
32 0.35
33 0.37
34 0.42
35 0.43
36 0.44
37 0.44
38 0.42
39 0.44
40 0.35
41 0.33
42 0.29
43 0.32
44 0.33
45 0.34
46 0.32
47 0.32
48 0.34
49 0.32
50 0.32
51 0.26
52 0.23
53 0.22
54 0.22
55 0.2
56 0.18
57 0.18
58 0.17
59 0.21
60 0.2
61 0.17
62 0.16
63 0.18
64 0.18
65 0.19
66 0.2
67 0.17
68 0.19
69 0.26
70 0.25
71 0.27
72 0.32
73 0.34
74 0.4
75 0.48
76 0.5
77 0.51
78 0.55
79 0.54
80 0.57
81 0.63
82 0.6
83 0.63
84 0.64
85 0.67
86 0.72
87 0.78
88 0.8
89 0.81
90 0.82
91 0.82
92 0.85
93 0.86
94 0.87
95 0.86