Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q4WM23

Protein Details
Accession Q4WM23    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-44QKNTSTTSRKAPKPPAPRLKLLVHydrophilic
NLS Segment(s)
PositionSequence
34-36KPP
203-242EKKANKAKEASSKSSRHAKGEKESKSEKVQAKKLLQRQDK
248-271PTGDKAEKKSRASDKASKEAVKAA
546-561RGPRGGRGSRNKGGSK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
IPR039722  Upf3  
IPR005120  UPF3_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005730  C:nucleolus  
GO:0003729  F:mRNA binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
GO:0045727  P:positive regulation of translation  
KEGG afm:AFUA_6G11460  -  
Pfam View protein in Pfam  
PF00076  RRM_1  
PF03467  Smg4_UPF3  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12455  RRM_like_Smg4_UPF3  
cd00590  RRM_SF  
Amino Acid Sequences MTQTSDGKSTGGVLQIPAAATQKNTSTTSRKAPKPPAPRLKLLVRRLPPGLTQSEFENAMGPEWMVGAGKVDWYQYKPGKVSKDYAKPSRPSRAYIHVTSSEHIAPLSDKVRQTSFVDARNTFNDPVLLGPPSLEFAPYAKIPGSRVRKDARQGTIDQDPEFIAFLESLTQPITKPTTVDTPTDAEEKKETVTTTPLVQYIKEKKANKAKEASSKSSRHAKGEKESKSEKVQAKKLLQRQDKDAALAPTGDKAEKKSRASDKASKEAVKAANRAANAAAKQAAKPAATQNTSKDTAQPASTERKRERNNIAVAAKILQRDLGLAPSGGRRRAGKGGSTETDSSKKEPDAAITADSGKKDTKSGKPMSPSTPRSKANATPPSGEPAPSRAQSGPNAGPTSAPSAQKQSKSAKGKPAAPITSPTATQAFLKHANPSQGVTEPLLETAFAPFGKILKVEIDKKKGFGYIDFAEPDGLQKAIAASPVTVAQSQVVVLERKANPGAEKTRGKGRSEQPAPNNGSNSNSNSNRGAKQGSDGGSGPATPSSSRGPRGGRGSRNKGGSKGNGANASSNTPSGKTGGETK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.15
6 0.14
7 0.14
8 0.16
9 0.18
10 0.21
11 0.24
12 0.29
13 0.33
14 0.38
15 0.47
16 0.54
17 0.59
18 0.64
19 0.72
20 0.76
21 0.8
22 0.85
23 0.86
24 0.83
25 0.81
26 0.79
27 0.79
28 0.78
29 0.76
30 0.75
31 0.69
32 0.67
33 0.63
34 0.59
35 0.52
36 0.48
37 0.44
38 0.37
39 0.33
40 0.3
41 0.3
42 0.29
43 0.26
44 0.23
45 0.18
46 0.16
47 0.16
48 0.13
49 0.1
50 0.09
51 0.09
52 0.06
53 0.06
54 0.07
55 0.07
56 0.08
57 0.09
58 0.11
59 0.14
60 0.16
61 0.25
62 0.28
63 0.33
64 0.36
65 0.41
66 0.47
67 0.48
68 0.53
69 0.54
70 0.59
71 0.62
72 0.67
73 0.69
74 0.69
75 0.72
76 0.76
77 0.69
78 0.64
79 0.61
80 0.61
81 0.6
82 0.55
83 0.54
84 0.49
85 0.48
86 0.43
87 0.41
88 0.33
89 0.26
90 0.23
91 0.18
92 0.13
93 0.16
94 0.17
95 0.19
96 0.19
97 0.22
98 0.24
99 0.26
100 0.27
101 0.32
102 0.34
103 0.36
104 0.41
105 0.39
106 0.41
107 0.41
108 0.42
109 0.34
110 0.3
111 0.24
112 0.18
113 0.18
114 0.17
115 0.14
116 0.11
117 0.1
118 0.1
119 0.11
120 0.1
121 0.09
122 0.08
123 0.08
124 0.11
125 0.1
126 0.12
127 0.12
128 0.13
129 0.15
130 0.24
131 0.32
132 0.33
133 0.39
134 0.43
135 0.48
136 0.55
137 0.6
138 0.56
139 0.52
140 0.5
141 0.48
142 0.49
143 0.45
144 0.37
145 0.3
146 0.25
147 0.21
148 0.19
149 0.15
150 0.09
151 0.07
152 0.06
153 0.08
154 0.07
155 0.08
156 0.08
157 0.08
158 0.08
159 0.11
160 0.14
161 0.12
162 0.12
163 0.14
164 0.2
165 0.22
166 0.23
167 0.23
168 0.22
169 0.23
170 0.27
171 0.25
172 0.2
173 0.19
174 0.19
175 0.18
176 0.17
177 0.16
178 0.13
179 0.15
180 0.15
181 0.15
182 0.16
183 0.18
184 0.16
185 0.17
186 0.23
187 0.28
188 0.34
189 0.4
190 0.41
191 0.47
192 0.56
193 0.62
194 0.6
195 0.59
196 0.57
197 0.59
198 0.63
199 0.62
200 0.6
201 0.57
202 0.56
203 0.59
204 0.56
205 0.52
206 0.51
207 0.49
208 0.5
209 0.56
210 0.56
211 0.53
212 0.54
213 0.51
214 0.51
215 0.54
216 0.51
217 0.49
218 0.5
219 0.51
220 0.55
221 0.59
222 0.6
223 0.62
224 0.63
225 0.58
226 0.57
227 0.55
228 0.48
229 0.43
230 0.39
231 0.3
232 0.24
233 0.22
234 0.17
235 0.13
236 0.13
237 0.12
238 0.1
239 0.13
240 0.2
241 0.25
242 0.27
243 0.33
244 0.39
245 0.46
246 0.52
247 0.56
248 0.54
249 0.55
250 0.57
251 0.51
252 0.45
253 0.43
254 0.41
255 0.36
256 0.32
257 0.27
258 0.26
259 0.24
260 0.24
261 0.2
262 0.17
263 0.14
264 0.13
265 0.14
266 0.12
267 0.12
268 0.14
269 0.14
270 0.12
271 0.13
272 0.16
273 0.18
274 0.2
275 0.21
276 0.21
277 0.24
278 0.26
279 0.25
280 0.23
281 0.2
282 0.2
283 0.19
284 0.18
285 0.16
286 0.24
287 0.27
288 0.32
289 0.34
290 0.41
291 0.45
292 0.51
293 0.54
294 0.52
295 0.52
296 0.51
297 0.48
298 0.39
299 0.35
300 0.3
301 0.26
302 0.19
303 0.16
304 0.1
305 0.09
306 0.09
307 0.09
308 0.08
309 0.06
310 0.06
311 0.07
312 0.11
313 0.13
314 0.13
315 0.15
316 0.15
317 0.18
318 0.24
319 0.24
320 0.23
321 0.25
322 0.28
323 0.28
324 0.3
325 0.28
326 0.25
327 0.28
328 0.26
329 0.24
330 0.21
331 0.2
332 0.19
333 0.18
334 0.17
335 0.17
336 0.16
337 0.15
338 0.14
339 0.16
340 0.15
341 0.15
342 0.15
343 0.13
344 0.13
345 0.15
346 0.21
347 0.25
348 0.32
349 0.37
350 0.4
351 0.44
352 0.48
353 0.51
354 0.54
355 0.54
356 0.53
357 0.55
358 0.53
359 0.5
360 0.51
361 0.49
362 0.5
363 0.52
364 0.47
365 0.43
366 0.42
367 0.44
368 0.4
369 0.36
370 0.27
371 0.23
372 0.25
373 0.22
374 0.24
375 0.2
376 0.23
377 0.23
378 0.28
379 0.26
380 0.26
381 0.26
382 0.24
383 0.22
384 0.21
385 0.25
386 0.23
387 0.22
388 0.2
389 0.27
390 0.32
391 0.34
392 0.39
393 0.39
394 0.44
395 0.51
396 0.55
397 0.57
398 0.58
399 0.6
400 0.62
401 0.63
402 0.56
403 0.49
404 0.47
405 0.42
406 0.38
407 0.33
408 0.28
409 0.21
410 0.19
411 0.19
412 0.17
413 0.17
414 0.2
415 0.21
416 0.23
417 0.25
418 0.28
419 0.28
420 0.27
421 0.25
422 0.22
423 0.23
424 0.2
425 0.18
426 0.15
427 0.14
428 0.13
429 0.11
430 0.09
431 0.08
432 0.09
433 0.08
434 0.08
435 0.08
436 0.09
437 0.09
438 0.09
439 0.09
440 0.13
441 0.19
442 0.27
443 0.35
444 0.42
445 0.43
446 0.44
447 0.45
448 0.43
449 0.38
450 0.31
451 0.3
452 0.24
453 0.26
454 0.25
455 0.24
456 0.21
457 0.2
458 0.2
459 0.15
460 0.12
461 0.08
462 0.08
463 0.09
464 0.09
465 0.1
466 0.09
467 0.08
468 0.09
469 0.11
470 0.12
471 0.11
472 0.11
473 0.1
474 0.09
475 0.09
476 0.1
477 0.11
478 0.11
479 0.12
480 0.19
481 0.2
482 0.23
483 0.25
484 0.26
485 0.25
486 0.31
487 0.36
488 0.37
489 0.41
490 0.41
491 0.49
492 0.52
493 0.53
494 0.55
495 0.56
496 0.59
497 0.61
498 0.67
499 0.63
500 0.68
501 0.71
502 0.66
503 0.62
504 0.52
505 0.49
506 0.45
507 0.44
508 0.44
509 0.39
510 0.39
511 0.41
512 0.45
513 0.43
514 0.43
515 0.4
516 0.32
517 0.33
518 0.36
519 0.33
520 0.3
521 0.29
522 0.27
523 0.25
524 0.24
525 0.2
526 0.15
527 0.15
528 0.12
529 0.14
530 0.2
531 0.25
532 0.29
533 0.34
534 0.37
535 0.43
536 0.52
537 0.58
538 0.61
539 0.66
540 0.72
541 0.73
542 0.77
543 0.73
544 0.69
545 0.68
546 0.64
547 0.63
548 0.6
549 0.59
550 0.55
551 0.53
552 0.51
553 0.45
554 0.44
555 0.36
556 0.32
557 0.28
558 0.24
559 0.24
560 0.22
561 0.21