Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZSS2

Protein Details
Accession A0A0F7ZSS2    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPGVSKKKAPARKTRMSPDKLLHydrophilic
NLS Segment(s)
PositionSequence
7-13KKAPARK
Subcellular Location(s) mito 16, nucl 7, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
Pfam View protein in Pfam  
PF13919  ASXH  
Amino Acid Sequences MPGVSKKKAPARKTRMSPDKLLTSLRSPLAKADLKAIFSKPLTWTALAVNEQAEILSLFPDSRHIIKGGVDFLDMPDLDALMNDKGFRDDCAAYKSNLADGRHDAGWLAEAWAAHEMRKAGQYDAYLRAKFEDDWGVKIPEETQEPRISEGEPDRKPTTDLGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.81
4 0.79
5 0.74
6 0.7
7 0.63
8 0.57
9 0.49
10 0.42
11 0.41
12 0.38
13 0.33
14 0.27
15 0.27
16 0.3
17 0.31
18 0.27
19 0.3
20 0.29
21 0.29
22 0.31
23 0.3
24 0.27
25 0.24
26 0.26
27 0.21
28 0.23
29 0.23
30 0.21
31 0.21
32 0.18
33 0.21
34 0.19
35 0.17
36 0.13
37 0.11
38 0.11
39 0.1
40 0.08
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.07
48 0.08
49 0.1
50 0.11
51 0.11
52 0.12
53 0.13
54 0.14
55 0.13
56 0.11
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.07
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.04
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.07
75 0.09
76 0.1
77 0.11
78 0.16
79 0.17
80 0.17
81 0.18
82 0.17
83 0.18
84 0.21
85 0.21
86 0.18
87 0.19
88 0.21
89 0.2
90 0.19
91 0.16
92 0.11
93 0.12
94 0.1
95 0.08
96 0.06
97 0.06
98 0.07
99 0.1
100 0.1
101 0.09
102 0.11
103 0.11
104 0.11
105 0.15
106 0.15
107 0.13
108 0.15
109 0.17
110 0.19
111 0.26
112 0.3
113 0.27
114 0.26
115 0.27
116 0.27
117 0.25
118 0.24
119 0.26
120 0.21
121 0.24
122 0.27
123 0.27
124 0.25
125 0.26
126 0.24
127 0.19
128 0.23
129 0.23
130 0.25
131 0.28
132 0.29
133 0.32
134 0.32
135 0.29
136 0.29
137 0.35
138 0.4
139 0.37
140 0.43
141 0.43
142 0.43
143 0.45