Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZP02

Protein Details
Accession A0A0F7ZP02    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
74-94EPPRRRDLAHVLRQRRRRPHGBasic
NLS Segment(s)
PositionSequence
89-90RR
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MSWSCAFLKHYPPTKTSASRSAFPRPAKRRNTHLVQVAHDLVQRRRKGAVDVEKDAVRVAAPQLPPQVPHHLLEPPRRRDLAHVLRQRRRRPHGLEAHHDRCVGSIVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.52
4 0.53
5 0.48
6 0.5
7 0.53
8 0.57
9 0.57
10 0.58
11 0.63
12 0.63
13 0.68
14 0.72
15 0.73
16 0.72
17 0.73
18 0.73
19 0.68
20 0.67
21 0.6
22 0.53
23 0.51
24 0.44
25 0.36
26 0.31
27 0.28
28 0.26
29 0.3
30 0.29
31 0.26
32 0.27
33 0.27
34 0.28
35 0.33
36 0.37
37 0.34
38 0.36
39 0.36
40 0.35
41 0.34
42 0.31
43 0.23
44 0.13
45 0.09
46 0.07
47 0.09
48 0.1
49 0.11
50 0.15
51 0.15
52 0.17
53 0.19
54 0.25
55 0.22
56 0.22
57 0.22
58 0.24
59 0.29
60 0.37
61 0.44
62 0.43
63 0.46
64 0.46
65 0.45
66 0.45
67 0.51
68 0.51
69 0.52
70 0.56
71 0.61
72 0.68
73 0.77
74 0.82
75 0.81
76 0.79
77 0.79
78 0.77
79 0.78
80 0.8
81 0.79
82 0.8
83 0.8
84 0.76
85 0.7
86 0.63
87 0.52
88 0.43