Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WPL6

Protein Details
Accession Q4WPL6    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
191-215VTYKRTQLEAPPKGKRRKCQEDKETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 6, cyto 4
Family & Domain DBs
KEGG afm:AFUA_4G09700  -  
Amino Acid Sequences MPSAKPVLHPLKTPKLTTKFPSELHNESSSSLSDGVKQEDGISTPITPPAAYTEFLKAFTPVFSSPASAGVSFPKFPFDRPAHSPTSQPSSAVSGSFVFNDPVRSATASLPPPTPFTAPASQASQPRRDPTSLRRLRIPQPLRYSPTTESPQSATTIRSPFSPSDWKLRYFEAPRSASGRVSVKHVVTRTVTYKRTQLEAPPKGKRRKCQEDKET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.59
3 0.63
4 0.62
5 0.62
6 0.57
7 0.54
8 0.57
9 0.54
10 0.51
11 0.5
12 0.47
13 0.39
14 0.34
15 0.34
16 0.28
17 0.23
18 0.2
19 0.15
20 0.17
21 0.18
22 0.2
23 0.19
24 0.18
25 0.17
26 0.16
27 0.17
28 0.15
29 0.14
30 0.11
31 0.11
32 0.13
33 0.12
34 0.11
35 0.1
36 0.13
37 0.14
38 0.14
39 0.15
40 0.19
41 0.19
42 0.21
43 0.21
44 0.17
45 0.15
46 0.15
47 0.16
48 0.11
49 0.13
50 0.12
51 0.12
52 0.12
53 0.14
54 0.14
55 0.12
56 0.12
57 0.14
58 0.15
59 0.15
60 0.15
61 0.17
62 0.17
63 0.18
64 0.25
65 0.24
66 0.28
67 0.32
68 0.37
69 0.38
70 0.38
71 0.39
72 0.34
73 0.38
74 0.32
75 0.27
76 0.22
77 0.2
78 0.2
79 0.18
80 0.16
81 0.1
82 0.11
83 0.11
84 0.11
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.09
91 0.09
92 0.1
93 0.1
94 0.14
95 0.14
96 0.16
97 0.16
98 0.16
99 0.17
100 0.17
101 0.17
102 0.14
103 0.16
104 0.17
105 0.17
106 0.19
107 0.2
108 0.21
109 0.26
110 0.28
111 0.3
112 0.29
113 0.31
114 0.32
115 0.31
116 0.32
117 0.34
118 0.42
119 0.43
120 0.43
121 0.46
122 0.48
123 0.53
124 0.6
125 0.57
126 0.54
127 0.56
128 0.59
129 0.58
130 0.55
131 0.53
132 0.45
133 0.46
134 0.43
135 0.36
136 0.32
137 0.29
138 0.28
139 0.26
140 0.25
141 0.2
142 0.2
143 0.21
144 0.2
145 0.2
146 0.22
147 0.2
148 0.24
149 0.3
150 0.28
151 0.36
152 0.38
153 0.4
154 0.39
155 0.41
156 0.44
157 0.4
158 0.44
159 0.43
160 0.42
161 0.42
162 0.43
163 0.42
164 0.35
165 0.36
166 0.34
167 0.26
168 0.3
169 0.32
170 0.3
171 0.34
172 0.34
173 0.34
174 0.31
175 0.35
176 0.37
177 0.4
178 0.41
179 0.39
180 0.44
181 0.43
182 0.44
183 0.41
184 0.44
185 0.47
186 0.54
187 0.59
188 0.63
189 0.7
190 0.77
191 0.82
192 0.83
193 0.83
194 0.85
195 0.87