Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZR24

Protein Details
Accession A0A0F7ZR24    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
61-84DASTMNTMRKRKRNTRISREKLPVHydrophilic
NLS Segment(s)
PositionSequence
70-77KRKRNTRI
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSGEIGELKTRVSEQSDAIRKLSATVYKQSTIIQGQEDLIRDLGSKVQEARRSLDARRSLDASTMNTMRKRKRNTRISREKLPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.27
3 0.34
4 0.35
5 0.34
6 0.33
7 0.29
8 0.29
9 0.3
10 0.26
11 0.21
12 0.25
13 0.27
14 0.27
15 0.28
16 0.27
17 0.26
18 0.22
19 0.21
20 0.16
21 0.13
22 0.13
23 0.14
24 0.14
25 0.11
26 0.1
27 0.09
28 0.08
29 0.08
30 0.09
31 0.08
32 0.08
33 0.1
34 0.14
35 0.18
36 0.19
37 0.23
38 0.26
39 0.28
40 0.29
41 0.35
42 0.37
43 0.36
44 0.37
45 0.36
46 0.3
47 0.3
48 0.31
49 0.26
50 0.24
51 0.25
52 0.27
53 0.31
54 0.38
55 0.44
56 0.51
57 0.59
58 0.64
59 0.72
60 0.78
61 0.84
62 0.88
63 0.91
64 0.9