Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZY44

Protein Details
Accession A0A0F7ZY44   
Localization Confidence Low
Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-83GFFYHHGQCCRRRHRRGHPWVYYDCHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 8, cyto 3, plas 3, nucl 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MLFKQLIAIAFLAGSSVVAMSQAPEAAVKARAVEGGAEDNLVARAEAANAADPCPAPGFFYHHGQCCRRRHRRGHPWVYYDCHRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.04
8 0.04
9 0.05
10 0.05
11 0.05
12 0.05
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.05
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.06
36 0.06
37 0.07
38 0.08
39 0.08
40 0.08
41 0.09
42 0.09
43 0.08
44 0.08
45 0.14
46 0.16
47 0.23
48 0.25
49 0.3
50 0.37
51 0.42
52 0.49
53 0.53
54 0.62
55 0.66
56 0.73
57 0.78
58 0.83
59 0.88
60 0.91
61 0.92
62 0.9
63 0.86
64 0.82
65 0.78