Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZTR6

Protein Details
Accession A0A0F7ZTR6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-114PKEVRCRRCAWRKEMRLGGEBasic
NLS Segment(s)
Subcellular Location(s) cysk 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MCLLVRELFWCPEEDCGTQWEGKPRLEPCQQGRALLLIDRAGLRHFRLRRPAAVRRAVPSGQDEGDGSGRDDEGLVAAALTAVANHRVREHWDEPKEVRCRRCAWRKEMRLGGEEVEKAKAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.2
4 0.22
5 0.22
6 0.24
7 0.29
8 0.29
9 0.29
10 0.34
11 0.34
12 0.39
13 0.42
14 0.47
15 0.43
16 0.49
17 0.48
18 0.43
19 0.41
20 0.35
21 0.3
22 0.24
23 0.2
24 0.1
25 0.11
26 0.1
27 0.1
28 0.09
29 0.1
30 0.11
31 0.17
32 0.2
33 0.24
34 0.33
35 0.35
36 0.41
37 0.47
38 0.53
39 0.53
40 0.57
41 0.54
42 0.47
43 0.49
44 0.42
45 0.36
46 0.3
47 0.24
48 0.18
49 0.16
50 0.14
51 0.11
52 0.11
53 0.1
54 0.09
55 0.07
56 0.07
57 0.06
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.08
71 0.09
72 0.1
73 0.11
74 0.13
75 0.17
76 0.25
77 0.3
78 0.34
79 0.37
80 0.42
81 0.44
82 0.51
83 0.56
84 0.55
85 0.54
86 0.5
87 0.53
88 0.58
89 0.66
90 0.66
91 0.66
92 0.71
93 0.75
94 0.79
95 0.8
96 0.74
97 0.67
98 0.6
99 0.54
100 0.47
101 0.4
102 0.33