Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZZB0

Protein Details
Accession A0A0F7ZZB0   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
72-96DIYYWATQQRRRRRRPQGHGVYAPAHydrophilic
NLS Segment(s)
PositionSequence
81-87RRRRRRP
Subcellular Location(s) mito 20, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005631  SDH  
IPR036714  SDH_sf  
IPR028882  SDHAF2  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006121  P:mitochondrial electron transport, succinate to ubiquinone  
GO:0018293  P:protein-FAD linkage  
Pfam View protein in Pfam  
PF03937  Sdh5  
Amino Acid Sequences MALTPRLLRPAPLRRTGESDETKRARLTYQSRKRGTLESDLLLSTFAAAHLPGMDGAQLDEYDRFLDENDWDIYYWATQQRRRRRRPQGHGVYAPAARPVTRARAARLAGVEHGGTEWEWRARVQTLGVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.58
3 0.59
4 0.59
5 0.57
6 0.55
7 0.55
8 0.54
9 0.53
10 0.48
11 0.44
12 0.37
13 0.38
14 0.42
15 0.44
16 0.52
17 0.6
18 0.62
19 0.64
20 0.64
21 0.61
22 0.55
23 0.51
24 0.44
25 0.35
26 0.32
27 0.29
28 0.26
29 0.21
30 0.17
31 0.09
32 0.06
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.08
56 0.08
57 0.08
58 0.08
59 0.09
60 0.09
61 0.08
62 0.1
63 0.12
64 0.16
65 0.22
66 0.31
67 0.42
68 0.53
69 0.62
70 0.71
71 0.77
72 0.83
73 0.88
74 0.9
75 0.89
76 0.87
77 0.8
78 0.72
79 0.65
80 0.54
81 0.45
82 0.36
83 0.26
84 0.18
85 0.17
86 0.17
87 0.2
88 0.26
89 0.28
90 0.29
91 0.35
92 0.36
93 0.37
94 0.35
95 0.3
96 0.25
97 0.25
98 0.21
99 0.14
100 0.13
101 0.11
102 0.1
103 0.1
104 0.12
105 0.12
106 0.13
107 0.14
108 0.17
109 0.18
110 0.2