Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A1I1

Protein Details
Accession A0A0F8A1I1   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-60DHTLENRLRKGRPKKLTRRELRYINLHydrophilic
299-326TSKETPPQSKNWKRNWLRGTPCRRNYLTHydrophilic
NLS Segment(s)
PositionSequence
41-90RLRKGRPKKLTRRELRYINLMIKRRRKITYRALLGAAGGRVSRRTLRRAI
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
IPR002492  Transposase_Tc1-like  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0015074  P:DNA integration  
GO:0006313  P:DNA transposition  
Pfam View protein in Pfam  
PF13358  DDE_3  
PF01498  HTH_Tnp_Tc3_2  
Amino Acid Sequences MVSQKKSGLSYQNVATEFLTNKSTVHRIVNRWEHDHTLENRLRKGRPKKLTRRELRYINLMIKRRRKITYRALLGAAGGRVSRRTLRRAIQPEWKRKWLSVQRIPISNETAEERLQFARTWEGREDELTEVIFSDESTVQNRGNNTRGWVFRKPHERFQRDLVNVTAHGKPEISIMVWAGIWRGGRTPLVIMRRDPAARRQGYSARSYRDALTEGLLPFYDGTRRFQQDNARIHTAGGTPEFLQSHAVEYIDWPSHSPDLNPIEHTWRLLKQKVIQLCPDIQDLKRNQASIALLEEIMTSKETPPQSKNWKRNWLRGTPCRRNYLTGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.37
3 0.32
4 0.28
5 0.25
6 0.24
7 0.18
8 0.18
9 0.21
10 0.24
11 0.24
12 0.31
13 0.36
14 0.39
15 0.48
16 0.57
17 0.58
18 0.59
19 0.59
20 0.54
21 0.5
22 0.54
23 0.47
24 0.47
25 0.47
26 0.47
27 0.5
28 0.52
29 0.54
30 0.56
31 0.64
32 0.64
33 0.7
34 0.76
35 0.81
36 0.86
37 0.92
38 0.92
39 0.9
40 0.89
41 0.86
42 0.79
43 0.75
44 0.69
45 0.66
46 0.63
47 0.62
48 0.62
49 0.63
50 0.65
51 0.64
52 0.66
53 0.64
54 0.65
55 0.68
56 0.69
57 0.67
58 0.63
59 0.58
60 0.51
61 0.46
62 0.38
63 0.28
64 0.18
65 0.12
66 0.09
67 0.09
68 0.11
69 0.17
70 0.2
71 0.25
72 0.31
73 0.36
74 0.46
75 0.52
76 0.55
77 0.59
78 0.64
79 0.7
80 0.7
81 0.72
82 0.64
83 0.58
84 0.63
85 0.61
86 0.62
87 0.6
88 0.63
89 0.6
90 0.63
91 0.65
92 0.56
93 0.5
94 0.39
95 0.32
96 0.25
97 0.23
98 0.18
99 0.16
100 0.15
101 0.13
102 0.14
103 0.13
104 0.12
105 0.18
106 0.19
107 0.21
108 0.21
109 0.22
110 0.21
111 0.22
112 0.23
113 0.16
114 0.15
115 0.12
116 0.11
117 0.09
118 0.08
119 0.07
120 0.05
121 0.06
122 0.07
123 0.07
124 0.09
125 0.11
126 0.11
127 0.13
128 0.15
129 0.16
130 0.17
131 0.17
132 0.18
133 0.21
134 0.24
135 0.27
136 0.33
137 0.33
138 0.37
139 0.47
140 0.48
141 0.53
142 0.6
143 0.58
144 0.54
145 0.57
146 0.59
147 0.49
148 0.47
149 0.39
150 0.29
151 0.26
152 0.26
153 0.22
154 0.14
155 0.13
156 0.11
157 0.1
158 0.1
159 0.09
160 0.07
161 0.06
162 0.05
163 0.06
164 0.05
165 0.05
166 0.05
167 0.06
168 0.06
169 0.06
170 0.06
171 0.07
172 0.07
173 0.08
174 0.09
175 0.12
176 0.17
177 0.18
178 0.18
179 0.19
180 0.22
181 0.23
182 0.24
183 0.26
184 0.31
185 0.31
186 0.32
187 0.34
188 0.36
189 0.38
190 0.43
191 0.4
192 0.35
193 0.35
194 0.36
195 0.33
196 0.29
197 0.27
198 0.21
199 0.18
200 0.17
201 0.15
202 0.14
203 0.13
204 0.11
205 0.1
206 0.1
207 0.12
208 0.1
209 0.15
210 0.21
211 0.24
212 0.25
213 0.29
214 0.37
215 0.42
216 0.48
217 0.5
218 0.48
219 0.45
220 0.44
221 0.41
222 0.34
223 0.27
224 0.2
225 0.15
226 0.12
227 0.14
228 0.14
229 0.12
230 0.13
231 0.12
232 0.13
233 0.12
234 0.12
235 0.1
236 0.11
237 0.14
238 0.14
239 0.13
240 0.12
241 0.14
242 0.16
243 0.17
244 0.16
245 0.2
246 0.23
247 0.25
248 0.26
249 0.25
250 0.29
251 0.29
252 0.3
253 0.27
254 0.28
255 0.33
256 0.35
257 0.38
258 0.39
259 0.45
260 0.51
261 0.52
262 0.49
263 0.47
264 0.45
265 0.43
266 0.4
267 0.37
268 0.31
269 0.35
270 0.35
271 0.4
272 0.4
273 0.38
274 0.34
275 0.34
276 0.35
277 0.28
278 0.28
279 0.2
280 0.16
281 0.16
282 0.16
283 0.12
284 0.12
285 0.12
286 0.1
287 0.1
288 0.16
289 0.21
290 0.26
291 0.29
292 0.38
293 0.48
294 0.58
295 0.67
296 0.7
297 0.77
298 0.79
299 0.86
300 0.84
301 0.83
302 0.83
303 0.84
304 0.85
305 0.85
306 0.84
307 0.83
308 0.77