Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8A361

Protein Details
Accession A0A0F8A361   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
66-88GTDHLLRRPRRQLRRPLPPPARHBasic
94-120RPGGPRARARRPARRRARRARPLHAGABasic
NLS Segment(s)
PositionSequence
71-115LRRPRRQLRRPLPPPARHARHQGRPGGPRARARRPARRRARRARP
Subcellular Location(s) mito 8, cyto 7, extr 6, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045865  ACT-like_dom_sf  
IPR002912  ACT_dom  
IPR002376  Formyl_transf_N  
IPR036477  Formyl_transf_N_sf  
IPR004810  PurU  
IPR044074  PurU_ACT  
Gene Ontology GO:0008864  F:formyltetrahydrofolate deformylase activity  
GO:0006189  P:'de novo' IMP biosynthetic process  
GO:0006520  P:amino acid metabolic process  
GO:0006730  P:one-carbon metabolic process  
Pfam View protein in Pfam  
PF01842  ACT  
PF00551  Formyl_trans_N  
PROSITE View protein in PROSITE  
PS51671  ACT  
CDD cd04875  ACT_F4HF-DF  
Amino Acid Sequences MAVTDDHILTLTCPDKPGIVHAVTGVFAAHHHNVLDLQQFSDPASRRFFMRVHFCPAGSAPPGRAGTDHLLRRPRRQLRRPLPPPARHARHQGRPGGPRARARRPARRRARRARPLHAGAVADAGARPYHQAYERGVKITGATAHFVTADLDEGPIIEQRVARVDHGMDPKELAEQGSNVESQVLAAAVRWYADRRVFLNGVKTVVFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.21
5 0.21
6 0.2
7 0.19
8 0.19
9 0.19
10 0.18
11 0.17
12 0.13
13 0.07
14 0.07
15 0.11
16 0.11
17 0.11
18 0.11
19 0.12
20 0.12
21 0.14
22 0.18
23 0.14
24 0.15
25 0.14
26 0.15
27 0.15
28 0.21
29 0.2
30 0.19
31 0.23
32 0.23
33 0.24
34 0.27
35 0.27
36 0.28
37 0.36
38 0.36
39 0.39
40 0.4
41 0.38
42 0.36
43 0.35
44 0.32
45 0.25
46 0.22
47 0.15
48 0.19
49 0.2
50 0.19
51 0.18
52 0.18
53 0.2
54 0.26
55 0.29
56 0.28
57 0.36
58 0.39
59 0.45
60 0.52
61 0.57
62 0.61
63 0.67
64 0.73
65 0.74
66 0.83
67 0.83
68 0.83
69 0.83
70 0.78
71 0.76
72 0.75
73 0.7
74 0.62
75 0.66
76 0.63
77 0.61
78 0.62
79 0.61
80 0.57
81 0.56
82 0.59
83 0.55
84 0.51
85 0.51
86 0.52
87 0.53
88 0.57
89 0.59
90 0.64
91 0.67
92 0.73
93 0.77
94 0.81
95 0.84
96 0.85
97 0.89
98 0.88
99 0.87
100 0.83
101 0.8
102 0.73
103 0.65
104 0.56
105 0.45
106 0.34
107 0.28
108 0.2
109 0.12
110 0.08
111 0.07
112 0.05
113 0.05
114 0.05
115 0.05
116 0.07
117 0.09
118 0.12
119 0.14
120 0.22
121 0.23
122 0.24
123 0.24
124 0.22
125 0.2
126 0.2
127 0.2
128 0.13
129 0.14
130 0.12
131 0.12
132 0.12
133 0.12
134 0.1
135 0.08
136 0.07
137 0.06
138 0.06
139 0.05
140 0.06
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.08
147 0.12
148 0.13
149 0.13
150 0.14
151 0.15
152 0.2
153 0.26
154 0.27
155 0.23
156 0.23
157 0.23
158 0.23
159 0.21
160 0.16
161 0.12
162 0.1
163 0.12
164 0.13
165 0.13
166 0.11
167 0.11
168 0.09
169 0.08
170 0.08
171 0.06
172 0.05
173 0.05
174 0.06
175 0.06
176 0.07
177 0.08
178 0.1
179 0.16
180 0.19
181 0.22
182 0.23
183 0.29
184 0.32
185 0.33
186 0.38
187 0.35
188 0.34