Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WZP8

Protein Details
Accession Q4WZP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-67PTHPADRRDKQRDKDRQRELBasic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 6, extr 5, cyto_mito 5, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG afm:AFUA_2G16190  -  
Amino Acid Sequences MSTPNNTPPYTPMPSLGHELGVMFGFIVACLLIMAVYTYFWRGMAINPTHPADRRDKQRDKDRQRELAQRAFRYERFRVGGPREKMQRDIGAPGGAGGTEMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.34
4 0.27
5 0.22
6 0.21
7 0.17
8 0.14
9 0.11
10 0.05
11 0.05
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.03
25 0.04
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.13
32 0.15
33 0.16
34 0.18
35 0.19
36 0.2
37 0.21
38 0.22
39 0.23
40 0.28
41 0.36
42 0.44
43 0.5
44 0.57
45 0.66
46 0.74
47 0.77
48 0.81
49 0.79
50 0.78
51 0.76
52 0.77
53 0.73
54 0.7
55 0.67
56 0.58
57 0.56
58 0.52
59 0.5
60 0.48
61 0.44
62 0.42
63 0.38
64 0.39
65 0.4
66 0.44
67 0.5
68 0.47
69 0.53
70 0.55
71 0.54
72 0.55
73 0.53
74 0.5
75 0.43
76 0.42
77 0.36
78 0.3
79 0.27
80 0.23
81 0.19
82 0.13