Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F7ZJ32

Protein Details
Accession A0A0F7ZJ32    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
45-64KDGICKRCIAKDKNKKEDEPBasic
152-173HLNRQFRRQFRVRRRCLQQWLDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 11.5, cyto 10.5, mito 1, plas 1, extr 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences MGDLSHCPLSDRDRVLLQKFWTELENDRMEHCARCQETWFDMGLKDGICKRCIAKDKNKKEDEPWFFSAENQLDFGLIPAFLPQLTKVEEMLIAPVHVFVNVMQVRGQQYKYRGHIVHFLRDVGKVYRQLPLLPPELDVILLRPPNAGEHAHLNRQFRRQFRVRRRCLQQWLDFLTNNHPGYRDITVCQKRMSVLPEDGDVLDQVATVELFEELPVLPEELDIVLLRPPDMEEGPRFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.45
4 0.42
5 0.39
6 0.37
7 0.36
8 0.31
9 0.28
10 0.28
11 0.3
12 0.31
13 0.27
14 0.27
15 0.29
16 0.29
17 0.28
18 0.26
19 0.27
20 0.26
21 0.27
22 0.29
23 0.3
24 0.3
25 0.3
26 0.3
27 0.22
28 0.2
29 0.2
30 0.19
31 0.15
32 0.16
33 0.2
34 0.22
35 0.21
36 0.23
37 0.24
38 0.3
39 0.39
40 0.45
41 0.5
42 0.58
43 0.68
44 0.76
45 0.8
46 0.75
47 0.72
48 0.73
49 0.7
50 0.66
51 0.58
52 0.51
53 0.45
54 0.43
55 0.43
56 0.34
57 0.26
58 0.2
59 0.17
60 0.13
61 0.13
62 0.13
63 0.07
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.07
72 0.09
73 0.1
74 0.09
75 0.1
76 0.1
77 0.1
78 0.1
79 0.08
80 0.06
81 0.05
82 0.06
83 0.05
84 0.05
85 0.05
86 0.04
87 0.12
88 0.12
89 0.13
90 0.12
91 0.14
92 0.17
93 0.19
94 0.2
95 0.16
96 0.19
97 0.24
98 0.27
99 0.31
100 0.29
101 0.28
102 0.35
103 0.34
104 0.35
105 0.3
106 0.28
107 0.23
108 0.23
109 0.23
110 0.17
111 0.17
112 0.15
113 0.16
114 0.18
115 0.18
116 0.18
117 0.19
118 0.21
119 0.22
120 0.19
121 0.19
122 0.16
123 0.15
124 0.14
125 0.12
126 0.09
127 0.09
128 0.09
129 0.09
130 0.08
131 0.08
132 0.09
133 0.11
134 0.11
135 0.09
136 0.16
137 0.19
138 0.25
139 0.29
140 0.33
141 0.34
142 0.42
143 0.46
144 0.42
145 0.47
146 0.5
147 0.57
148 0.64
149 0.72
150 0.72
151 0.76
152 0.81
153 0.81
154 0.82
155 0.8
156 0.74
157 0.7
158 0.67
159 0.61
160 0.54
161 0.47
162 0.43
163 0.41
164 0.36
165 0.3
166 0.25
167 0.23
168 0.25
169 0.27
170 0.23
171 0.18
172 0.27
173 0.33
174 0.34
175 0.34
176 0.32
177 0.31
178 0.33
179 0.34
180 0.29
181 0.26
182 0.25
183 0.25
184 0.25
185 0.23
186 0.2
187 0.17
188 0.12
189 0.09
190 0.07
191 0.06
192 0.05
193 0.05
194 0.04
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.05
201 0.07
202 0.08
203 0.08
204 0.08
205 0.07
206 0.08
207 0.07
208 0.09
209 0.07
210 0.07
211 0.09
212 0.09
213 0.1
214 0.09
215 0.1
216 0.13
217 0.15
218 0.19