Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q4WVJ0

Protein Details
Accession Q4WVJ0    Localization Confidence High Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
21-44AEKQRKLVKAAEKRKATKKTNSGDHydrophilic
277-298LEKINELKKKRKADKSGITDKDBasic
320-346GNESGGPSLKRQKKNEKYGFGGKKRHABasic
358-384RNFSVKKMKGGSKRPGKSKRAAAKGRSBasic
NLS Segment(s)
PositionSequence
24-39QRKLVKAAEKRKATKK
239-290AAAKKAAAEARKQRDLKKFGKQVQVAKLQQRQKEKRETLEKINELKKKRKAD
313-352NSRKRSRGNESGGPSLKRQKKNEKYGFGGKKRHAKSGDAI
357-384LRNFSVKKMKGGSKRPGKSKRAAAKGRS
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0034399  C:nuclear periphery  
GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0042802  F:identical protein binding  
GO:0000280  P:nuclear division  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0006364  P:rRNA processing  
KEGG afm:AFUA_5G12270  -  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MPKRSKLLQALDAHKGRDYDAEKQRKLVKAAEKRKATKKTNSGDGENKEEGTVETNGKAQSENLKSKKRNDSEDEVGSSDNADGESDKEATVEAEDSEEDEIDEEEEGEEEEEEEEEDIPLSDLSEDEREDVVPHQRLTINNSAAINTSIKRISFITSQTPFSEHNSLVSKEPIEVPDPNDDLNRELAFYKVCQAAASEARRLLKKEGVPFTRPGDYFAEMVKTDEHMSKIKKKLYDEAAAKKAAAEARKQRDLKKFGKQVQVAKLQQRQKEKRETLEKINELKKKRKADKSGITDKDNDLFDIAIEDSGKSNSRKRSRGNESGGPSLKRQKKNEKYGFGGKKRHAKSGDAISSGDLRNFSVKKMKGGSKRPGKSKRAAAKGRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.45
3 0.37
4 0.37
5 0.35
6 0.36
7 0.43
8 0.52
9 0.51
10 0.57
11 0.63
12 0.61
13 0.61
14 0.59
15 0.59
16 0.59
17 0.69
18 0.72
19 0.74
20 0.77
21 0.83
22 0.85
23 0.83
24 0.82
25 0.81
26 0.79
27 0.8
28 0.77
29 0.74
30 0.72
31 0.68
32 0.65
33 0.57
34 0.49
35 0.39
36 0.34
37 0.28
38 0.23
39 0.22
40 0.16
41 0.15
42 0.18
43 0.19
44 0.19
45 0.19
46 0.17
47 0.23
48 0.29
49 0.38
50 0.43
51 0.52
52 0.57
53 0.66
54 0.74
55 0.72
56 0.72
57 0.7
58 0.7
59 0.66
60 0.65
61 0.58
62 0.49
63 0.43
64 0.34
65 0.28
66 0.2
67 0.13
68 0.09
69 0.07
70 0.06
71 0.07
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.04
111 0.06
112 0.07
113 0.07
114 0.08
115 0.09
116 0.09
117 0.1
118 0.12
119 0.17
120 0.18
121 0.18
122 0.19
123 0.21
124 0.22
125 0.27
126 0.31
127 0.26
128 0.26
129 0.26
130 0.24
131 0.22
132 0.23
133 0.18
134 0.12
135 0.13
136 0.12
137 0.12
138 0.13
139 0.13
140 0.14
141 0.15
142 0.17
143 0.22
144 0.23
145 0.25
146 0.24
147 0.25
148 0.23
149 0.25
150 0.26
151 0.18
152 0.19
153 0.21
154 0.22
155 0.21
156 0.2
157 0.17
158 0.14
159 0.16
160 0.14
161 0.13
162 0.13
163 0.14
164 0.16
165 0.16
166 0.16
167 0.16
168 0.15
169 0.14
170 0.14
171 0.12
172 0.09
173 0.09
174 0.09
175 0.09
176 0.09
177 0.1
178 0.1
179 0.1
180 0.09
181 0.09
182 0.11
183 0.16
184 0.17
185 0.16
186 0.17
187 0.19
188 0.2
189 0.22
190 0.22
191 0.21
192 0.23
193 0.28
194 0.34
195 0.35
196 0.37
197 0.37
198 0.38
199 0.38
200 0.35
201 0.31
202 0.26
203 0.24
204 0.22
205 0.2
206 0.19
207 0.14
208 0.15
209 0.12
210 0.11
211 0.11
212 0.11
213 0.13
214 0.15
215 0.2
216 0.27
217 0.33
218 0.36
219 0.38
220 0.39
221 0.44
222 0.45
223 0.49
224 0.47
225 0.48
226 0.48
227 0.44
228 0.42
229 0.35
230 0.32
231 0.27
232 0.23
233 0.22
234 0.28
235 0.34
236 0.43
237 0.46
238 0.51
239 0.57
240 0.63
241 0.63
242 0.64
243 0.66
244 0.65
245 0.71
246 0.69
247 0.66
248 0.65
249 0.68
250 0.63
251 0.61
252 0.62
253 0.59
254 0.6
255 0.64
256 0.65
257 0.64
258 0.7
259 0.67
260 0.69
261 0.72
262 0.71
263 0.7
264 0.71
265 0.68
266 0.65
267 0.68
268 0.66
269 0.63
270 0.67
271 0.66
272 0.68
273 0.72
274 0.74
275 0.76
276 0.79
277 0.83
278 0.83
279 0.85
280 0.8
281 0.73
282 0.66
283 0.58
284 0.53
285 0.43
286 0.34
287 0.24
288 0.18
289 0.15
290 0.14
291 0.12
292 0.08
293 0.08
294 0.08
295 0.08
296 0.1
297 0.15
298 0.16
299 0.22
300 0.32
301 0.4
302 0.47
303 0.55
304 0.63
305 0.69
306 0.76
307 0.77
308 0.74
309 0.71
310 0.72
311 0.69
312 0.61
313 0.56
314 0.57
315 0.59
316 0.6
317 0.64
318 0.67
319 0.72
320 0.81
321 0.86
322 0.83
323 0.81
324 0.83
325 0.84
326 0.82
327 0.8
328 0.76
329 0.77
330 0.73
331 0.74
332 0.67
333 0.61
334 0.59
335 0.61
336 0.59
337 0.51
338 0.48
339 0.4
340 0.42
341 0.38
342 0.33
343 0.23
344 0.18
345 0.24
346 0.24
347 0.26
348 0.31
349 0.32
350 0.37
351 0.45
352 0.53
353 0.55
354 0.64
355 0.71
356 0.72
357 0.79
358 0.83
359 0.85
360 0.84
361 0.84
362 0.85
363 0.84
364 0.84