Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F7ZXJ8

Protein Details
Accession A0A0F7ZXJ8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MARKPNRQKVKTTKAGPKAKARRSRGRARSRDRGRGRGRWBasic
NLS Segment(s)
PositionSequence
3-39RKPNRQKVKTTKAGPKAKARRSRGRARSRDRGRGRGR
Subcellular Location(s) mito 10, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MARKPNRQKVKTTKAGPKAKARRSRGRARSRDRGRGRGRWACKAVEHPSRPTHPAEGDERRGAARQCTDDPLCDPRVSTEDYDLGVRAEARGIRAILPTKQYCDGATVTEEKLLLFLVEEVAGRPFHSYEEWPICSSLNAFLGRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.86
3 0.82
4 0.82
5 0.82
6 0.82
7 0.83
8 0.82
9 0.82
10 0.82
11 0.86
12 0.86
13 0.86
14 0.87
15 0.86
16 0.88
17 0.86
18 0.88
19 0.84
20 0.84
21 0.81
22 0.78
23 0.78
24 0.77
25 0.73
26 0.71
27 0.66
28 0.58
29 0.52
30 0.51
31 0.49
32 0.49
33 0.47
34 0.44
35 0.46
36 0.47
37 0.47
38 0.43
39 0.38
40 0.3
41 0.29
42 0.31
43 0.32
44 0.32
45 0.3
46 0.28
47 0.26
48 0.27
49 0.25
50 0.2
51 0.18
52 0.17
53 0.18
54 0.21
55 0.21
56 0.19
57 0.21
58 0.22
59 0.21
60 0.18
61 0.16
62 0.13
63 0.15
64 0.16
65 0.15
66 0.12
67 0.11
68 0.12
69 0.12
70 0.11
71 0.09
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.09
80 0.09
81 0.12
82 0.14
83 0.15
84 0.2
85 0.2
86 0.22
87 0.23
88 0.23
89 0.21
90 0.22
91 0.2
92 0.15
93 0.17
94 0.16
95 0.15
96 0.15
97 0.15
98 0.12
99 0.12
100 0.1
101 0.08
102 0.06
103 0.05
104 0.05
105 0.05
106 0.06
107 0.06
108 0.08
109 0.08
110 0.08
111 0.09
112 0.09
113 0.1
114 0.13
115 0.15
116 0.21
117 0.28
118 0.31
119 0.3
120 0.31
121 0.3
122 0.28
123 0.27
124 0.22
125 0.2